Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human, Mouse VPS18 Monoclonal Antibody | anti-VPS18 antibody

VPS18 (Vacuolar Protein Sorting-associated Protein 18 Homolog, hVPS18, KIAA1475, PEP3)

Gene Names
VPS18; PEP3
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
VPS18; Monoclonal Antibody; VPS18 (Vacuolar Protein Sorting-associated Protein 18 Homolog; hVPS18; KIAA1475; PEP3); Anti -VPS18 (Vacuolar Protein Sorting-associated Protein 18 Homolog; anti-VPS18 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
2G10
Specificity
Recognizes human VPS18. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
SILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKV
Applicable Applications for anti-VPS18 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa3-101 from human VPS18 (NP_065908) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(VPS18 monoclonal antibody. Western Blot analysis of VPS18 expression in Raw 264.7.)

Western Blot (WB) (VPS18 monoclonal antibody. Western Blot analysis of VPS18 expression in Raw 264.7.)

Testing Data

(Detection limit for recombinant GST tagged VPS18 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged VPS18 is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-VPS18 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
110,186 Da
NCBI Official Full Name
vacuolar protein sorting-associated protein 18 homolog
NCBI Official Synonym Full Names
vacuolar protein sorting 18 homolog (S. cerevisiae)
NCBI Official Symbol
VPS18
NCBI Official Synonym Symbols
PEP3
NCBI Protein Information
vacuolar protein sorting-associated protein 18 homolog; hVPS18; vacuolar protein sorting protein 18
UniProt Protein Name
Vacuolar protein sorting-associated protein 18 homolog
UniProt Gene Name
VPS18
UniProt Synonym Gene Names
KIAA1475; hVPS18
UniProt Entry Name
VPS18_HUMAN

NCBI Description

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps18 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: May play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes. Ref.5

Subunit structure: Interacts with HOOK1

By similarity. Part of a large heterooligomeric complex together with VPS11, VPS16 and VPS33A. Interacts with STX7. Ref.5

Subcellular location: Late endosome membrane; Peripheral membrane protein; Cytoplasmic side. Lysosome membrane; Peripheral membrane protein; Cytoplasmic side. Note: Cytoplasmic, peripheral membrane protein associated with late endosomes/lysosomes. Ref.5 Ref.6

Tissue specificity: Ubiquitous. Expression was highest in heart and low in lung. Ref.5

Sequence similarities: Belongs to the VPS18 family.Contains 1 CHCR (clathrin heavy-chain) repeat.Contains 1 RING-type zinc finger.

Sequence caution: The sequence AAH01513.1 differs from that shown. Reason: Unlikely isoform. Aberrant splice sites.The sequence BAA95999.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Research Articles on VPS18

Similar Products

Product Notes

The VPS18 vps18 (Catalog #AAA647182) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The VPS18 (Vacuolar Protein Sorting-associated Protein 18 Homolog, hVPS18, KIAA1475, PEP3) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's VPS18 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the VPS18 vps18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SILDEYENSL SRSAVLQPGC PSVGIPHSGY VNAQLEKEVP IFTKQRIDFT PSERITSLVV SSNQLCMSLG KDTLLRIDLG KANEPNHVEL GRKDDAKV. It is sometimes possible for the material contained within the vial of "VPS18, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.