Mouse anti-Human, Mouse VPS18 Monoclonal Antibody | anti-VPS18 antibody

VPS18 (Vacuolar Protein Sorting-associated Protein 18 Homolog, hVPS18, KIAA1475, PEP3)

Cat. Num. AAA647182

• Gene Names: VPS18; PEP3
• Reactivity: Human, Mouse
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: VPS18; Monoclonal Antibody; VPS18 (Vacuolar Protein Sorting-associated Protein 18 Homolog; hVPS18; KIAA1475; PEP3); Anti -VPS18 (Vacuolar Protein Sorting-associated Protein 18 Homolog; anti-VPS18 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 2G10
• Specificity: Recognizes human VPS18. Species Crossreactivity: mouse.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: SILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKV

• Applicable Applications for anti-VPS18 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa3-101 from human VPS18 (NP_065908) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(VPS18 monoclonal antibody. Western Blot analysis of VPS18 expression in Raw 264.7.)

Testing Data

(Detection limit for recombinant GST tagged VPS18 is ~3ng/ml as a capture antibody.)

Product Categories/Family for anti-VPS18 antibody

Antibodies; Abs to Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 17978485
• NCBI GeneID: 57617
• NCBI Accession #: NP_065908.1
• NCBI GenBank Nucleotide #: NM_020857.2
• UniProt Accession #: Q9P253; Q8TCG0; Q96DI3; Q9H268
• Molecular Weight: 110,186 Da
• NCBI Official Full Name: vacuolar protein sorting-associated protein 18 homolog
• NCBI Official Synonym Full Names: vacuolar protein sorting 18 homolog (S. cerevisiae)
• NCBI Official Symbol: VPS18
• NCBI Official Synonym Symbols: PEP3
• NCBI Protein Information: vacuolar protein sorting-associated protein 18 homolog; hVPS18; vacuolar protein sorting protein 18
• UniProt Protein Name: Vacuolar protein sorting-associated protein 18 homolog
• Protein Family: Vacuolar protein sorting-associated protein
• UniProt Gene Name: VPS18
• UniProt Synonym Gene Names: KIAA1475; hVPS18
• UniProt Entry Name: VPS18_HUMAN

NCBI Description

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps18 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: May play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes. Ref.5

Subunit structure: Interacts with HOOK1

By similarity. Part of a large heterooligomeric complex together with VPS11, VPS16 and VPS33A. Interacts with STX7. Ref.5

Subcellular location: Late endosome membrane; Peripheral membrane protein; Cytoplasmic side. Lysosome membrane; Peripheral membrane protein; Cytoplasmic side. Note: Cytoplasmic, peripheral membrane protein associated with late endosomes/lysosomes. Ref.5 Ref.6

Tissue specificity: Ubiquitous. Expression was highest in heart and low in lung. Ref.5

Sequence similarities: Belongs to the VPS18 family.Contains 1 CHCR (clathrin heavy-chain) repeat.Contains 1 RING-type zinc finger.

Sequence caution: The sequence AAH01513.1 differs from that shown. Reason: Unlikely isoform. Aberrant splice sites.The sequence BAA95999.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.