Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of VNN1 transfected lysate using VNN1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with VNN1 rabbit polyclonal antibody.)

Mouse anti-Human VNN1 Monoclonal Antibody | anti-VNN1 antibody

VNN1 (Vascular Non-inflammatory Molecule 1, Vanin-1, Pantetheinase, Pantetheine Hydrolase, Tiff66, HDLCQ8) (Biotin)

Gene Names
VNN1; HDLCQ8; Tiff66
Reactivity
Human
Applications
ELISA, Immunoprecipitation
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
VNN1; Monoclonal Antibody; VNN1 (Vascular Non-inflammatory Molecule 1; Vanin-1; Pantetheinase; Pantetheine Hydrolase; Tiff66; HDLCQ8) (Biotin); EC=3.5.1.92; anti-VNN1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B10
Specificity
Recognizes human VNN1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-VNN1 antibody
ELISA (EIA), Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa298-398 from VNN1 (NP_004657) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KLLLSQLDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQKDLCCHLSYKMSENIPNEVYALGAFDGLHTVEGRYYLQI
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of VNN1 transfected lysate using VNN1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with VNN1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of VNN1 transfected lysate using VNN1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with VNN1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged VNN1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged VNN1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-VNN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,012 Da
NCBI Official Full Name
pantetheinase
NCBI Official Synonym Full Names
vanin 1
NCBI Official Symbol
VNN1
NCBI Official Synonym Symbols
HDLCQ8; Tiff66
NCBI Protein Information
pantetheinase; pantetheine hydrolase; vanin-1; vannin 1; vascular non-inflammatory molecule 1
UniProt Protein Name
Pantetheinase
Protein Family
UniProt Gene Name
VNN1
UniProt Synonym Gene Names
Vanin-1
UniProt Entry Name
VNN1_HUMAN

Uniprot Description

VNN1: Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine. Belongs to the CN hydrolase family. BTD/VNN subfamily.

Protein type: Motility/polarity/chemotaxis; EC 3.5.1.92; Hydrolase; Membrane protein, integral; Cofactor and Vitamin Metabolism - pantothenate and CoA biosynthesis; Cell adhesion; Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 6q23-q24

Cellular Component: integral to membrane; plasma membrane

Molecular Function: pantetheine hydrolase activity

Biological Process: positive regulation of T cell differentiation in the thymus; chronic inflammatory response; cell-cell adhesion; pantothenate metabolic process; innate immune response; response to oxidative stress; cell motility; inflammatory response; acute inflammatory response

Similar Products

Product Notes

The VNN1 vnn1 (Catalog #AAA6145142) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The VNN1 (Vascular Non-inflammatory Molecule 1, Vanin-1, Pantetheinase, Pantetheine Hydrolase, Tiff66, HDLCQ8) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VNN1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the VNN1 vnn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "VNN1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.