Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human VCX3A Monoclonal Antibody | anti-VCX3A antibody

VCX3A (Variable Charge X-linked Protein 3, VCX3, Variable Charge Protein on X with Eight Repeats, VCX8R, VCX-8r, Variably Charged Protein X-A, VCXA, VCX-A)

Gene Names
VCX3A; VCX3; VCXA; VCX-A; VCX8R; VCX-8r
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
VCX3A; Monoclonal Antibody; VCX3A (Variable Charge X-linked Protein 3; VCX3; Variable Charge Protein on X with Eight Repeats; VCX8R; VCX-8r; Variably Charged Protein X-A; VCXA; VCX-A); Anti -VCX3A (Variable Charge X-linked Protein 3; anti-VCX3A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6A3
Specificity
Recognizes human VCX3A.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
SPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQ
Applicable Applications for anti-VCX3A antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa2-101 from human VCX3A (NP_057463) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of VCX3A expression in transfected 293T cell line by VCX3A monoclonal antibody.|Lane 1: VCX3A transfected lysate (17.8kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of VCX3A expression in transfected 293T cell line by VCX3A monoclonal antibody.|Lane 1: VCX3A transfected lysate (17.8kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged VCX3A is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged VCX3A is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-VCX3A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,020 Da
NCBI Official Full Name
variable charge X-linked protein 3
NCBI Official Synonym Full Names
variable charge, X-linked 3A
NCBI Official Symbol
VCX3A
NCBI Official Synonym Symbols
VCX3; VCXA; VCX-A; VCX8R; VCX-8r
NCBI Protein Information
variable charge X-linked protein 3; variably charged X-A; variably charged protein X-A; variable charge protein on X with eight repeats
UniProt Protein Name
Variable charge X-linked protein 3
UniProt Gene Name
VCX3A
UniProt Synonym Gene Names
VCX3; VCX8R; VCXA; VCX-8r; VCX-A
UniProt Entry Name
VCX3_HUMAN

NCBI Description

This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 8 repeats of the 30-bp unit. [provided by RefSeq, Jul 2008]

Uniprot Description

VCX3A: May mediate a process in spermatogenesis or may play a role in sex ratio distortion. Belongs to the VCX/VCY family.

Chromosomal Location of Human Ortholog: Xp22

Cellular Component: nucleolus; nucleus

Biological Process: brain development

Research Articles on VCX3A

Similar Products

Product Notes

The VCX3A vcx3a (Catalog #AAA6012075) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The VCX3A (Variable Charge X-linked Protein 3, VCX3, Variable Charge Protein on X with Eight Repeats, VCX8R, VCX-8r, Variably Charged Protein X-A, VCXA, VCX-A) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VCX3A can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the VCX3A vcx3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SPKPRASGPP AKATEAGKRK SSSQPSPSDP KKKTTKVAKK GKAVRRGRRG KKGAATKMAA VTAPEAESGP AAPGPSDQPS QELPQHELPP EEPVSEGTQ. It is sometimes possible for the material contained within the vial of "VCX3A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.