Mouse VAV1 Monoclonal Antibody | anti-VAV1 antibody

VAV1 (Vav 1 Guanine Nucleotide Exchange Factor, VAV) (APC)

Cat. Num. AAA6166187

• Gene Names: VAV1; VAV
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: VAV1; Monoclonal Antibody; VAV1 (Vav 1 Guanine Nucleotide Exchange Factor; VAV) (APC); Vav 1 Guanine Nucleotide Exchange Factor; VAV; anti-VAV1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 9C1
• Specificity: Recognizes VAV1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 790

• Applicable Applications for anti-VAV1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: VAV1 (AAH13361, 681aa-790aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to VAV1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to VAV1 on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(VAV1 monoclonal antibody (M01), clone 9C1 Western Blot analysis of VAV1 expression in Jurkat.)

Related Product Information for anti-VAV1 antibody

The protein encoded by this proto-oncogene is a member of the Dbl family of guanine nucleotide exchange factors (GEF) for the Rho family of GTP binding proteins. The protein is important in hematopoiesis, playing a role in T-cell and B-cell development and activation. This particular GEF has been identified as the specific binding partner of Nef proteins from HIV-1. Coexpression and binding of these partners initiates profound morphological changes, cytoskeletal rearrangements and the JNK/SAPK signaling cascade, leading to increased levels of viral transcription and replication. [provided by RefSeq]

Product Categories/Family for anti-VAV1 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 33991320
• NCBI GeneID: 7409
• NCBI Official Full Name: VAV1 protein
• NCBI Official Synonym Full Names: vav guanine nucleotide exchange factor 1
• NCBI Official Symbol: VAV1
• NCBI Official Synonym Symbols: VAV
• NCBI Protein Information: proto-oncogene vav
• Protein Family: Proto-oncogene

NCBI Description

This gene is a member of the VAV gene family. The VAV proteins are guanine nucleotide exchange factors (GEFs) for Rho family GTPases that activate pathways leading to actin cytoskeletal rearrangements and transcriptional alterations. The encoded protein is important in hematopoiesis, playing a role in T-cell and B-cell development and activation. The encoded protein has been identified as the specific binding partner of Nef proteins from HIV-1. Coexpression and binding of these partners initiates profound morphological changes, cytoskeletal rearrangements and the JNK/SAPK signaling cascade, leading to increased levels of viral transcription and replication. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Apr 2012]