Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human Vasohibin-1 Monoclonal Antibody | anti-VASH1 antibody

Vasohibin-1 (VASH1, VASH, KIAA1036) (PE)

Gene Names
VASH1; TTCP 1; KIAA1036
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Vasohibin-1; Monoclonal Antibody; Vasohibin-1 (VASH1; VASH; KIAA1036) (PE); anti-VASH1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A3
Specificity
Recognizes human VASH1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
6449
Applicable Applications for anti-VASH1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa3-101 from VASH1 (NP_055724) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATD*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(VASH1 monoclonal antibody Western Blot analysis of VASH1 expression in HepG2)

Western Blot (WB) (VASH1 monoclonal antibody Western Blot analysis of VASH1 expression in HepG2)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to VASH1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to VASH1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged VASH1 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged VASH1 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-VASH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens vasohibin 1 (VASH1), mRNA
NCBI Official Synonym Full Names
vasohibin 1
NCBI Official Symbol
VASH1
NCBI Official Synonym Symbols
TTCP 1; KIAA1036
NCBI Protein Information
tubulinyl-Tyr carboxypeptidase 1
UniProt Protein Name
Vasohibin-1
Protein Family
UniProt Gene Name
VASH1
UniProt Synonym Gene Names
KIAA1036; VASH
UniProt Entry Name
VASH1_HUMAN

Uniprot Description

VASH1: Angiogenesis inhibitor. Inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. Does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. Acts in an autocrine manner. Inhibits artery neointimal formation and macrophage infiltration. Exhibits heparin-binding activity. Belongs to the vasohibin family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: extracellular space; endoplasmic reticulum; apical part of cell; cytoplasm

Biological Process: negative regulation of angiogenesis; negative regulation of endothelial cell proliferation; response to wounding; angiogenesis; negative regulation of blood vessel endothelial cell migration; cell cycle arrest

Research Articles on VASH1

Similar Products

Product Notes

The VASH1 vash1 (Catalog #AAA6161032) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Vasohibin-1 (VASH1, VASH, KIAA1036) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Vasohibin-1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the VASH1 vash1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Vasohibin-1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.