Mouse anti-Human Vascular Endothelial Growth Factor A Monoclonal Antibody | anti-VEGFA antibody

Vascular Endothelial Growth Factor A (VEGFA, VEGF-A, VEGF, Vascular Permeability Factor, VPF, MVCD1) (AP)

Cat. Num. AAA6134528

• Gene Names: VEGFA; VPF; VEGF; MVCD1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Vascular Endothelial Growth Factor A; Monoclonal Antibody; Vascular Endothelial Growth Factor A (VEGFA; VEGF-A; VEGF; Vascular Permeability Factor; VPF; MVCD1) (AP); anti-VEGFA antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F7
• Specificity: Recognizes human VEGF.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 395

• Applicable Applications for anti-VEGFA antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa27-130 from human VEGF (NP_003367) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCEC
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged VEGF is ~0.3ng/ml using as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of VEGF expression in transfected 293T cell line using. Lane 1: VEGF transfected lysate (17.2kD). Lane 2: Non-transfected lysate.)

Testing Data

Product Categories/Family for anti-VEGFA antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 76781481
• NCBI GeneID: 7422
• NCBI Accession #: NP_003367
• NCBI GenBank Nucleotide #: NM_003376
• UniProt Accession #: P15692
• NCBI Official Full Name: vascular endothelial growth factor A isoform b
• NCBI Official Synonym Full Names: vascular endothelial growth factor A
• NCBI Official Symbol: VEGFA
• NCBI Official Synonym Symbols: VPF; VEGF; MVCD1
• NCBI Protein Information: vascular endothelial growth factor A
• UniProt Protein Name: Vascular endothelial growth factor A
• Protein Family: Vascular endothelial growth factor
• UniProt Gene Name: VEGFA
• UniProt Synonym Gene Names: VEGF; VEGF-A; VPF
• UniProt Entry Name: VEGFA_HUMAN

NCBI Description

This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Elevated levels of this protein are found in patients with POEMS syndrome, also known as Crow-Fukase syndrome. Allelic variants of this gene have been associated with microvascular complications of diabetes 1 (MVCD1) and atherosclerosis. Alternatively spliced transcript variants encoding different isoforms have been described. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site. [provided by RefSeq, Nov 2015]

Uniprot Description

Function: Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Ref.27 Ref.30 Ref.33

Subunit structure: Homodimer; disulfide-linked. Also found as heterodimer with PGF

By similarity.

Subcellular location: Secreted. Note: VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a signicant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin. Ref.26 Ref.28 Ref.32

Tissue specificity: Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed.

Induction: Regulated by growth factors, cytokines, gonadotropins, nitric oxide, hypoxia, hypoglycemia and oncogenic mutations.

Involvement in disease: Microvascular complications of diabetes 1 (MVCD1) [MIM:603933]: Pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.

Sequence similarities: Belongs to the PDGF/VEGF growth factor family.

Sequence caution: The sequence AAC63102.1 differs from that shown. Reason: Erroneous initiation. The sequence AAC63143.1 differs from that shown. Reason: Unusual initiator. The initiator methionine is coded by a non-canonical CTG leucine codon.The sequence CAC19512.2 differs from that shown. Reason: Unusual initiator. The initiator methionine is coded by a non-canonical CTG leucine codon.The sequence CAC19516.2 differs from that shown. Reason: Unusual initiator. The initiator methionine is coded by a non-canonical CTG leucine codon.