Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.7kD).)

Mouse anti-Human VAC14 Monoclonal Antibody | anti-VAC14 antibody

VAC14 (Protein VAC14 Homolog, Tax1-binding Protein 2, TAX1BP2, TRX, ArPIKfyve) (Biotin)

Gene Names
VAC14; TRX; TAX1BP2; ArPIKfyve
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
VAC14; Monoclonal Antibody; VAC14 (Protein VAC14 Homolog; Tax1-binding Protein 2; TAX1BP2; TRX; ArPIKfyve) (Biotin); anti-VAC14 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B2
Specificity
Recognizes human VAC14.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-VAC14 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
ELISA: 0.1ng/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa714-783 from human VAC14 (NP_060522) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEVRHQRSGRGDHLDRRVVL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.7kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.7kD).)

Testing Data

(Detection limit for recombinant GST tagged VAC14 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged VAC14 is 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-VAC14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,783 Da
NCBI Official Full Name
protein VAC14 homolog
NCBI Official Synonym Full Names
Vac14 homolog (S. cerevisiae)
NCBI Official Symbol
VAC14
NCBI Official Synonym Symbols
TRX; TAX1BP2; ArPIKfyve
NCBI Protein Information
protein VAC14 homolog
UniProt Protein Name
Protein VAC14 homolog
UniProt Gene Name
VAC14
UniProt Synonym Gene Names
TAX1BP2; TRX
UniProt Entry Name
VAC14_HUMAN

NCBI Description

The content of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2) in endosomal membranes changes dynamically with fission and fusion events that generate or absorb intracellular transport vesicles. VAC14 is a component of a trimolecular complex that tightly regulates the level of PtdIns(3,5)P2. Other components of this complex are the PtdIns(3,5)P2-synthesizing enzyme PIKFYVE (MIM 609414) and the PtdIns(3,5)P2 phosphatase FIG4 (MIM 609390). VAC14 functions as an activator of PIKFYVE (Sbrissa et al., 2007 [PubMed 17556371]).[supplied by OMIM, Feb 2010]

Uniprot Description

VAC14: The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). Acts as a positive activator of PIKfyve kinase activity. Also required to maintain normal levels of phosphatidylinositol 3-phosphate (PtdIns(3)P) and phosphatidylinositol 5-phosphate (PtdIns(5)P). Plays a role in the biogenesis of endosome carrier vesicles (ECV) / multivesicular bodies (MVB) transport intermediates from early endosomes. Belongs to the VAC14 family.

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: Golgi membrane; endoplasmic reticulum; late endosome membrane; early endosome membrane; endosome membrane

Molecular Function: protein binding; receptor activity

Biological Process: viral reproduction; phospholipid metabolic process; phosphatidylinositol biosynthetic process; regulation of lipid kinase activity; signal transduction

Research Articles on VAC14

Similar Products

Product Notes

The VAC14 vac14 (Catalog #AAA6145115) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The VAC14 (Protein VAC14 Homolog, Tax1-binding Protein 2, TAX1BP2, TRX, ArPIKfyve) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VAC14 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). ELISA: 0.1ng/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the VAC14 vac14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "VAC14, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.