Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to USP9X on HeLa cell. [antibody concentration 10 ug/ml])
Mouse USP9X Monoclonal Antibody | anti-USP9X antibody
USP9X (Ubiquitin Specific Peptidase 9, X-Linked, DFFRX, FAF, FAM) (APC)
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
USP9X; Monoclonal Antibody; USP9X (Ubiquitin Specific Peptidase 9; X-Linked; DFFRX; FAF; FAM) (APC); Ubiquitin Specific Peptidase 9; FAM; anti-USP9X antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C4
Specificity
Recognizes USP9X.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-USP9X antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
USP9X (NP_068706, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLP
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to USP9X on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to USP9X on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to USP9X on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to USP9X on HeLa cell. [antibody concentration 10 ug/ml])
Testing Data
(Detection limit for recombinant GST tagged USP9X is approximately 0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged USP9X is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-USP9X antibody
This gene is a member of the peptidase C19 family and encodes a protein that is similar to ubiquitin-specific proteases. Though this gene is located on the X chromosome, it escapes X-inactivation. Mutations in this gene have been associated with Turner syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]
Product Categories/Family for anti-USP9X antibody
References
1. Role of Ku70 in deubiquitination of Mcl-1 and suppression of apoptosis.Wang B, Xie M, Li R, Owonikoko TK, Ramalingam SS, Khuri FR, Curran WJ, Wang Y, Deng XCell Death Differ. 2014 Apr 25. doi: 10.1038/cdd.2014.42. 2.Deubiquitinase USP9x Confers Radioresistance through Stabilization of Mcl-1. Trivigno D, Essmann F, Huber SM, Rudner J.Neoplasia. 2012 Oct;14(10):893-904. 3.Mcl-1 phosphorylation defines ABT-737 resistance that can be overcome by increased NOXA expression in leukemic B-cells. Mazumder S, Choudhary GS, Al-Harbi S, Almasan A.Cancer Res. 2012 Apr 23. 4.The Bcl-xL inhibitor, ABT-737, efficiently induces apoptosis and suppresses growth of hepatoma cells in combination with sorafenib.Hikita H, Takehara T, Shimizu S, Kodama T, Shigekawa M, Iwase K, Hosui A, Miyagi T, Tatsumi T, Ishida H, Li W, Kanto T, Hiramatsu N, Hayashi N.Hepatology (2010) DOI: 10.1002/ hep.23836
NCBI and Uniprot Product Information
NCBI GI #
Protein Family
Similar Products
Product Notes
The USP9X (Catalog #AAA6166211) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's USP9X can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the USP9X for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "USP9X, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
