Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged USP5 is ~0.03ng/ml as a capture antibody)

Mouse anti-Human USP5 Monoclonal Antibody | anti-USP5 antibody

USP5 (Ubiquitin-specific-processing Protease 5, Ubiquitin Carboxyl-terminal Hydrolase 5, Deubiquitinating Enzyme 5, Isopeptidase T, ISOT, Ubiquitin Thioesterase 5) (AP)

Gene Names
USP5; ISOT
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
USP5; Monoclonal Antibody; USP5 (Ubiquitin-specific-processing Protease 5; Ubiquitin Carboxyl-terminal Hydrolase 5; Deubiquitinating Enzyme 5; Isopeptidase T; ISOT; Ubiquitin Thioesterase 5) (AP); EC=3.4.19.12; anti-USP5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C8
Specificity
Recognizes human USP5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-USP5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa71-181 from USP5 (NP_003472) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDVKIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged USP5 is ~0.03ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged USP5 is ~0.03ng/ml as a capture antibody)

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)
Product Categories/Family for anti-USP5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93,308 Da
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 5 isoform 2
NCBI Official Synonym Full Names
ubiquitin specific peptidase 5 (isopeptidase T)
NCBI Official Symbol
USP5
NCBI Official Synonym Symbols
ISOT
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 5
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 5
UniProt Gene Name
USP5
UniProt Synonym Gene Names
ISOT
UniProt Entry Name
UBP5_HUMAN

NCBI Description

Ubiquitin (see MIM 191339)-dependent proteolysis is a complex pathway of protein metabolism implicated in such diverse cellular functions as maintenance of chromatin structure, receptor function, and degradation of abnormal proteins. A late step of the process involves disassembly of the polyubiquitin chains on degraded proteins into ubiquitin monomers. USP5 disassembles branched polyubiquitin chains by a sequential exo mechanism, starting at the proximal end of the chain (Wilkinson et al., 1995 [PubMed 7578059]).[supplied by OMIM, Mar 2010]

Uniprot Description

USP5: Cleaves linear and branched multiubiquitin polymers with a marked preference for branched polymers. Involved in unanchored 'Lys-48'-linked polyubiquitin disassembly. Binds linear and 'Lys- 63'-linked polyubiquitin with a lower affinity. Knock-down of USP5 causes the accumulation of p53/TP53 and an increase in p53/TP53 transcriptional activity because the unanchored polyubiquitin that accumulates is able to compete with ubiquitinated p53/TP53 but not with MDM2 for proteasomal recognition. Belongs to the peptidase C19 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.19.12; Ubiquitin-specific protease; Protease

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: lysosome

Molecular Function: omega peptidase activity; protein binding; zinc ion binding; cysteine-type endopeptidase activity; ubiquitin-specific protease activity

Biological Process: ubiquitin-dependent protein catabolic process; positive regulation of proteasomal ubiquitin-dependent protein catabolic process

Research Articles on USP5

Similar Products

Product Notes

The USP5 usp5 (Catalog #AAA6134501) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The USP5 (Ubiquitin-specific-processing Protease 5, Ubiquitin Carboxyl-terminal Hydrolase 5, Deubiquitinating Enzyme 5, Isopeptidase T, ISOT, Ubiquitin Thioesterase 5) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's USP5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the USP5 usp5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "USP5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.