Mouse anti-Human USP33 Monoclonal Antibody | anti-USP33 antibody

USP33 (Ubiquitin-specific-processing Protease 33, Ubiquitin Carboxyl-terminal Hydrolase 33, Deubiquitinating Enzyme 33, Ubiquitin Thioesterase 33, VHL-interacting Deubiquitinating Enzyme 1, VDU1, hVDU1, KIAA1097) APC

Cat. Num. AAA6139796

• Gene Names: USP33; VDU1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: USP33; Monoclonal Antibody; USP33 (Ubiquitin-specific-processing Protease 33; Ubiquitin Carboxyl-terminal Hydrolase 33; Deubiquitinating Enzyme 33; Ubiquitin Thioesterase 33; VHL-interacting Deubiquitinating Enzyme 1; VDU1; hVDU1; KIAA1097) APC; EC=3.4.19.12; anti-USP33 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5B5
• Specificity: Recognizes human USP33.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 4506

• Applicable Applications for anti-USP33 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; IF: 20ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa327-427 from USP33 (NP_055832) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDLSTPQIL*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of USP33 expression in transfected 293T cell line by USP33 monoclonal antibody Lane 1: USP33 transfected lysate (103.3kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to USP33 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to USP33 on HeLa cell. [antibody concentration 20ug/ml])

Testing Data

(Detection limit for recombinant GST tagged USP33 is ~0.1ng/ml as a capture antibody.)

Immunoprecipitation (IP)

(Immunoprecipitation of USP33 transfected lysate using anti-USP33 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with USP33 rabbit polyclonal antibody.)

Product Categories/Family for anti-USP33 antibody

Antibodies; Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 1794418751
• NCBI GeneID: 23032
• NCBI Accession #: NM_015017.5
• NCBI GenBank Nucleotide #: NM_015017
• UniProt Accession #: Q8TEY7
• NCBI Official Full Name: Homo sapiens ubiquitin specific peptidase 33 (USP33), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: ubiquitin specific peptidase 33
• NCBI Official Symbol: USP33
• NCBI Official Synonym Symbols: VDU1
• NCBI Protein Information: ubiquitin carboxyl-terminal hydrolase 33
• UniProt Protein Name: Ubiquitin carboxyl-terminal hydrolase 33
• Protein Family: Ubiquitin carboxyl-terminal hydrolase
• UniProt Gene Name: USP33
• UniProt Synonym Gene Names: KIAA1097; VDU1
• UniProt Entry Name: UBP33_HUMAN

NCBI Description

This gene encodes a deubiquinating enzyme important in a variety of processes, including Slit-dependent cell migration and beta-2 adrenergic receptor signaling. The protein is negatively regulated through ubiquitination by von Hippel-Lindau tumor protein (VHL). Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jun 2012]