Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human USP3 Monoclonal Antibody | anti-USP3 antibody

USP3 (Ubiquitin-specific-processing Protease 3, Ubiquitin Carboxyl-terminal Hydrolase 3, Deubiquitinating Enzyme 3, Ubiquitin Thioesterase 3, UBP, SIH003) (AP)

Gene Names
USP3; UBP; SIH003
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
USP3; Monoclonal Antibody; USP3 (Ubiquitin-specific-processing Protease 3; Ubiquitin Carboxyl-terminal Hydrolase 3; Deubiquitinating Enzyme 3; Ubiquitin Thioesterase 3; UBP; SIH003) (AP); EC=3.4.19.12; anti-USP3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H2
Specificity
Recognizes human USP3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
5517
Applicable Applications for anti-USP3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa421-520 from USP3 (NP_006528) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTVTLTDEETVVKAKAYILFYVEHQAKAGSDKL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of USP3 expression in transfected 293T cell line by USP3 monoclonal antibody Lane 1: USP3 transfected lysate (58.9kD). Lane 2: Non-transfected lysate. )

Western Blot (WB) (Western Blot analysis of USP3 expression in transfected 293T cell line by USP3 monoclonal antibody Lane 1: USP3 transfected lysate (58.9kD). Lane 2: Non-transfected lysate. )

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to USP3 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to USP3 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged USP3 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged USP3 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-USP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens ubiquitin specific peptidase 3 (USP3), transcript variant 1, mRNA
NCBI Official Synonym Full Names
ubiquitin specific peptidase 3
NCBI Official Symbol
USP3
NCBI Official Synonym Symbols
UBP; SIH003
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 3
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 3
UniProt Gene Name
USP3
UniProt Entry Name
UBP3_HUMAN

Uniprot Description

USP3: Hydrolase that deubiquitinates monoubiquitinated target proteins such as histone H2A and H2B. Required for proper progression through S phase and subsequent mitotic entry. May regulate the DNA damage response (DDR) checkpoint through deubiquitination of H2A at DNA damage sites. Associates with the chromatin. Belongs to the peptidase C19 family. USP3 subfamily.

Protein type: Protease; Ubiquitin-specific protease; EC 3.4.19.12; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 15q22.3

Cellular Component: nuclear chromatin

Molecular Function: zinc ion binding; histone binding; cysteine-type endopeptidase activity; ubiquitin-specific protease activity; chromatin binding

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; regulation of transcription, DNA-dependent; regulation of protein stability; mitotic cell cycle; negative regulation of transcription from RNA polymerase II promoter; DNA repair; histone deubiquitination

Research Articles on USP3

Similar Products

Product Notes

The USP3 usp3 (Catalog #AAA6134491) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The USP3 (Ubiquitin-specific-processing Protease 3, Ubiquitin Carboxyl-terminal Hydrolase 3, Deubiquitinating Enzyme 3, Ubiquitin Thioesterase 3, UBP, SIH003) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's USP3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the USP3 usp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "USP3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.