Mouse anti-Human USP26 Monoclonal Antibody | anti-USP26 antibody

USP26 (Ubiquitin-specific-processing Protease 26, Ubiquitin Carboxyl-terminal Hydrolase 26, Deubiquitinating Enzyme 26, Ubiquitin Thioesterase 26)

Cat. Num. AAA6002820

• Reactivity: Human
• Applications: ELISA
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: USP26; Monoclonal Antibody; USP26 (Ubiquitin-specific-processing Protease 26; Ubiquitin Carboxyl-terminal Hydrolase 26; Deubiquitinating Enzyme 26; Ubiquitin Thioesterase 26); Anti -USP26 (Ubiquitin-specific-processing Protease 26; anti-USP26 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G8
• Specificity: Recognizes human USP26.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAALFLRGFVQIGNCKTGISKSKEAFIEAVERKKKDRLVLYFKSGKYSTFRLSDNIQNVVLKSYRGNQNHLHLTLQNNNGLFIEGLSSTDAEQLKIFLDRVHQNEVQPPV

• Applicable Applications for anti-USP26 antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.
• Immunogen: Partial recombinant corresponding to aa1-111 from human USP26 with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Categories/Family for anti-USP26 antibody

Antibodies; Abs to Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 13994268
• NCBI GeneID: 83844
• NCBI Accession #: NP_114113.1
• NCBI GenBank Nucleotide #: NM_031907.1
• UniProt Accession #: Q9BXU7; Q5H9H4; B9WRT6
• Molecular Weight: 104,047 Da
• NCBI Official Full Name: ubiquitin carboxyl-terminal hydrolase 26
• NCBI Official Synonym Full Names: ubiquitin specific peptidase 26
• NCBI Official Symbol: USP26
• NCBI Protein Information: ubiquitin carboxyl-terminal hydrolase 26; ubiquitin thioesterase 26; deubiquitinating enzyme 26; ubiquitin thiolesterase 26; ubiquitin specific protease 26; ubiquitin-specific processing protease 26; ubiquitin-specific-processing protease 26
• UniProt Protein Name: Ubiquitin carboxyl-terminal hydrolase 26
• UniProt Gene Name: USP26
• UniProt Entry Name: UBP26_HUMAN

NCBI Description

This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases and is a deubiquitinating enzyme (DUB) with His and Cys domains. It is specifically expressed in testis tissue. Mutations in this gene have been associated with Sertoli cell-only syndrome and male infertility. [provided by RefSeq, Jul 2008]

Uniprot Description

USP26: Involved in the ubiquitin-dependent proteolytic pathway in conjunction with the 26S proteasome. Deubiquitinates the androgen receptor and regulates the androgen receptor signaling pathway. Belongs to the peptidase C19 family.

Protein type: Ubiquitin conjugating system; Ubiquitin-specific protease; EC 3.4.19.12; Protease

Chromosomal Location of Human Ortholog: Xq26.2

Cellular Component: nucleus

Molecular Function: protein binding; cysteine-type endopeptidase activity; ubiquitin-specific protease activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; protein deubiquitination

Disease: Spermatogenic Failure, X-linked, 1