Western Blot (WB)
(Western Blot detection against Immunogen (51.59kD).)
Mouse anti-Human USP15 Monoclonal Antibody | anti-USP15 antibody
USP15 (Ubiquitin-specific-processing Protease 15, Ubiquitin Carboxyl-terminal Hydrolase 15, Deubiquitinating Enzyme 15, Ubiquitin Thioesterase 15, Unph-2, Unph4, KIAA0529) (HRP)
Gene Names
USP15; UNPH4; UNPH-2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
USP15; Monoclonal Antibody; USP15 (Ubiquitin-specific-processing Protease 15; Ubiquitin Carboxyl-terminal Hydrolase 15; Deubiquitinating Enzyme 15; Ubiquitin Thioesterase 15; Unph-2; Unph4; KIAA0529) (HRP); EC=3.4.19.12; anti-USP15 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C10
Specificity
Recognizes human USP15.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-USP15 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length protein corresponding to aa1-235 from USP15 (AAH20688) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKKPLEQSC
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (51.59kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (51.59kD).)
Western Blot (WB)
(USP15 monoclonal antibody Western Blot analysis of USP15 expression in HepG2.)
Western Blot (WB)
(USP15 monoclonal antibody Western Blot analysis of USP15 expression in HepG2.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to USP15 on HeLa cell. [antibody concentration 10ug/ml].)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to USP15 on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-USP15 antibody
References
1. The Human COP9 Signalosome Protects Ubiquitin-conjugating Enzyme 3 (UBC3/Cdc34) from {beta}-Transducin Repeat-containing Protein ({beta}TrCP)-mediated Degradation. Fernandez-Sanchez ME, Sechet E, Margottin-Goguet F, Rogge L, Bianchi E.J Biol Chem. 2010 Jun 4;285(23):17390-7. Epub 2010 Apr 8. 2. COP9 Signalosome Interacts ATP-dependently with p97/Valosin-containing Protein (VCP) and Controls the Ubiquitination Status of Proteins Bound to p97/VCP. Cayli S, Klug J, Chapiro J, Frohlich S, Krasteva G, Orel L, Meinhardt A.J Biol Chem. 2009 Dec 11;284(50):34944-53. Epub 2009 Oct 13. 3. USP15 plays an essential role for caspase-3 activation during Paclitaxel-induced apoptosis. Xu M, Takanashi M, Oikawa K, Tanaka M, Nishi H, Isaka K, Kudo M, Kuroda M.Biochem Biophys Res Commun. 2009 Oct 16;388(2):366-71. Epub 2009 Aug 8. 4. The Ubiquitin Specific Peptidase USP15 Regulates Human Papilloma Virus 16 E6 Protein Stability. Vos RM, Altreuter J, White EA, Howley PM.J Virol. 2009 Sep;83(17):8885-92. Epub 2009 Jun 24. 5. The COP9/signalosome increases the efficiency of pVHL ubiquitin ligase-mediated hypoxia inducible factor-alpha ubiquitination. Miyauchi Y, Kato M, Tokunaga F, Iwai K.J Biol Chem. 2008 Jun 13;283(24):16622-16631. Epub 2008 Apr 18. 6. CSN controls NF-kappaB by deubiquitinylation of IkappaBalpha. Schweitzer K, Bozko PM, Dubiel W, Naumann M.EMBO J. 2007 Mar 21;26(6):1532-41. Epub 2007 Feb 22.
NCBI and Uniprot Product Information
NCBI Description
This gene encodes a member of the ubiquitin specific protease (USP) family of deubiquitinating enzymes. USP enzymes play critical roles in ubiquitin-dependent processes through polyubiquitin chain disassembly and hydrolysis of ubiquitin-substrate bonds. The encoded protein associates with the COP9 signalosome, and also plays a role in transforming growth factor beta signalling through deubiquitination of receptor-activated SMAD transcription factors. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 2. [provided by RefSeq, Nov 2011]
Research Articles on USP15
Similar Products
Product Notes
The USP15 (Catalog #AAA6155699) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The USP15 (Ubiquitin-specific-processing Protease 15, Ubiquitin Carboxyl-terminal Hydrolase 15, Deubiquitinating Enzyme 15, Ubiquitin Thioesterase 15, Unph-2, Unph4, KIAA0529) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's USP15 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the USP15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "USP15, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
