Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (USF2 monoclonal antibody Western Blot analysis of USF2 expression in HeLa.)

Mouse anti-Human, Rat USF2 Monoclonal Antibody | anti-USF2 antibody

USF2 (Upstream Stimulatory Factor 2, Class B Basic Helix-loop-helix Protein 12, bHLHb12, FOS-interacting Protein, FIP, Major Late Transcription Factor 2, Upstream Transcription Factor 2) (PE)

Gene Names
USF2; FIP; bHLHb12
Reactivity
Human, Rat
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
USF2; Monoclonal Antibody; USF2 (Upstream Stimulatory Factor 2; Class B Basic Helix-loop-helix Protein 12; bHLHb12; FOS-interacting Protein; FIP; Major Late Transcription Factor 2; Upstream Transcription Factor 2) (PE); anti-USF2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5E9
Specificity
Recognizes human USF2. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-USF2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human USF2 (NP_003358) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(USF2 monoclonal antibody Western Blot analysis of USF2 expression in HeLa.)

Western Blot (WB) (USF2 monoclonal antibody Western Blot analysis of USF2 expression in HeLa.)

Western Blot (WB)

(USF2 monoclonal antibody. Western Blot analysis of USF2 expression in PC-12.)

Western Blot (WB) (USF2 monoclonal antibody. Western Blot analysis of USF2 expression in PC-12.)

Testing Data

(Detection limit for recombinant GST tagged USF2 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged USF2 is ~0.3ng/ml as a capture antibody.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to USF2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to USF2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to USF2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to USF2 on HeLa cell. [antibody concentration 10ug/ml])

Western Blot (WB)

(USF2 monoclonal antibody. Western Blot analysis of USF2 expression in different cell lines.)

Western Blot (WB) (USF2 monoclonal antibody. Western Blot analysis of USF2 expression in different cell lines.)

Western Blot (WB)

(Western Blot analysis of USF2 expression in transfected 293T cell line by USF2 monoclonal antibody,. Lane 1: USF2 transfected lysate (37kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of USF2 expression in transfected 293T cell line by USF2 monoclonal antibody,. Lane 1: USF2 transfected lysate (37kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-USF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
upstream stimulatory factor 2 isoform 1
NCBI Official Synonym Full Names
upstream transcription factor 2, c-fos interacting
NCBI Official Symbol
USF2
NCBI Official Synonym Symbols
FIP; bHLHb12
NCBI Protein Information
upstream stimulatory factor 2
UniProt Protein Name
Upstream stimulatory factor 2
UniProt Gene Name
USF2
UniProt Synonym Gene Names
BHLHB12; bHLHb12; FIP
UniProt Entry Name
USF2_HUMAN

NCBI Description

This gene encodes a member of the basic helix-loop-helix leucine zipper family of transcription factors. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs and is involved in regulating multiple cellular processes. [provided by RefSeq, Mar 2016]

Uniprot Description

USF2: Transcription factor that binds to a symmetrical DNA sequence (E-boxes) (5'-CACGTG-3') that is found in a variety of viral and cellular promoters. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 19q13

Cellular Component: nucleoplasm; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; protein homodimerization activity; sequence-specific DNA binding; protein heterodimerization activity; double-stranded DNA binding; bHLH transcription factor binding; transcription factor activity

Biological Process: lactation; transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter by glucose; lipid homeostasis; late viral mRNA transcription; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription from RNA polymerase II promoter by glucose

Research Articles on USF2

Similar Products

Product Notes

The USF2 usf2 (Catalog #AAA6160997) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The USF2 (Upstream Stimulatory Factor 2, Class B Basic Helix-loop-helix Protein 12, bHLHb12, FOS-interacting Protein, FIP, Major Late Transcription Factor 2, Upstream Transcription Factor 2) (PE) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's USF2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the USF2 usf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "USF2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.