Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of UMOD expression in transfected 293T cell line by 135096 Lane 1: UMOD transfected lysate (Predicted MW: 66.7kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human Uromodulin Monoclonal Antibody | anti-UMOD antibody

Uromodulin (UMOD, Tamm-Horsfall Urinary Glycoprotein, THP) (FITC)

Gene Names
UMOD; THP; FJHN; HNFJ; THGP; HNFJ1; MCKD2; ADMCKD2
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Uromodulin; Monoclonal Antibody; Uromodulin (UMOD; Tamm-Horsfall Urinary Glycoprotein; THP) (FITC); ADMCKD2; FJHN; HNFJ; HNFJ1; MCKD2; THGP; anti-UMOD antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3F10
Specificity
Recognizes human UMOD.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-UMOD antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa25-120 from human UMOD with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHC
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of UMOD expression in transfected 293T cell line by 135096 Lane 1: UMOD transfected lysate (Predicted MW: 66.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of UMOD expression in transfected 293T cell line by 135096 Lane 1: UMOD transfected lysate (Predicted MW: 66.7kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of UMOD transfected lysate using 135096 and Protein A Magnetic Bead and immunoblotted with UMOD MaxPab rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of UMOD transfected lysate using 135096 and Protein A Magnetic Bead and immunoblotted with UMOD MaxPab rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged UMOD is 0.3ng/ml using 135096 as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UMOD is 0.3ng/ml using 135096 as a capture antibody.)
Product Categories/Family for anti-UMOD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
uromodulin isoform a preproprotein
NCBI Official Synonym Full Names
uromodulin
NCBI Official Symbol
UMOD
NCBI Official Synonym Symbols
THP; FJHN; HNFJ; THGP; HNFJ1; MCKD2; ADMCKD2
NCBI Protein Information
uromodulin; Tamm-Horsfall urinary glycoprotein; uromucoid
UniProt Protein Name
Uromodulin
Protein Family
UniProt Gene Name
UMOD
UniProt Synonym Gene Names
THP
UniProt Entry Name
UROM_HUMAN

NCBI Description

The protein encoded by this gene is the most abundant protein in mammalian urine under physiological conditions. Its excretion in urine follows proteolytic cleavage of the ectodomain of its glycosyl phosphatidylinosital-anchored counterpart that is situated on the luminal cell surface of the loop of Henle. This protein may act as a constitutive inhibitor of calcium crystallization in renal fluids. Excretion of this protein in urine may provide defense against urinary tract infections caused by uropathogenic bacteria. Defects in this gene are associated with the renal disorders medullary cystic kidney disease-2 (MCKD2), glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI), and familial juvenile hyperuricemic nephropathy (FJHN). Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

UMOD: Uromodulin: Functions in biogenesis and organization of the apical membrane of epithelial cells of the thick ascending limb of Henle's loop (TALH), where it promotes formation of complex filamentous gel-like structure providing the water barrier permeability. May serve as a receptor for binding and endocytosis for cytokines (IL-1, IL-2) and TNF. Facilitates neutrophil migration across renal epithelial. Defects in UMOD are the cause of familial juvenile hyperuricemic nephropathy type 1 (HNFJ1). HNFJ1 is a renal disease characterized by juvenil onset of hyperuricemia, polyuria, progressive renal failure, and gout. The disease is associated with interstitial pathological changes resulting in fibrosis. Defects in UMOD are the cause of medullary cystic kidney disease type 2 (MCKD2). MCKD2 is a form of tubulointerstitial nephropathy characterized by formation of renal cysts at the corticomedullary junction. It is characterized by adult onset of impaired renal function and salt wasting resulting in end-stage renal failure by the sixth decade. Defects in UMOD are the cause of glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI). GCKDHI is a renal disorder characterized by a cystic dilation of Bowman space, a collapse of glomerular tuft, and hyperuricemia due to low fractional excretion of uric acid and severe impairment of urine concentrating ability. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 16p12.3

Cellular Component: Golgi apparatus; spindle pole; extracellular space; extrinsic to membrane; basolateral plasma membrane; apical plasma membrane; cytoplasmic vesicle; lipid raft

Molecular Function: IgG binding; calcium ion binding

Biological Process: heterophilic cell adhesion; response to organic substance; negative regulation of cell proliferation; leukocyte adhesion; cellular defense response; excretion; chemical homeostasis

Disease: Hyperuricemic Nephropathy, Familial Juvenile, 1; Glomerulocystic Kidney Disease With Hyperuricemia And Isosthenuria; Medullary Cystic Kidney Disease 2

Research Articles on UMOD

Similar Products

Product Notes

The UMOD umod (Catalog #AAA6150373) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Uromodulin (UMOD, Tamm-Horsfall Urinary Glycoprotein, THP) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Uromodulin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UMOD umod for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Uromodulin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.