Mouse anti-Human Urokinase Monoclonal Antibody | anti-uPA antibody

Urokinase (Urokinase-type Plasminogen Activator, U-plasminogen Activator, uPA, PLAU) (MaxLight 490)

Cat. Num. AAA6204018

• Gene Names: PLAU; ATF; QPD; UPA; URK; u-PA; BDPLT5
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Urokinase; Monoclonal Antibody; Urokinase (Urokinase-type Plasminogen Activator; U-plasminogen Activator; uPA; PLAU) (MaxLight 490); anti-uPA antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3B8
• Specificity: Recognizes human PLAU.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

• Applicable Applications for anti-uPA antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa16-115 from human PLAU (AAH13575) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLG
• Conjugate: MaxLight490
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-uPA antibody

Urokinase is a serine protease involved in degradation of the extracellular matrix and possibly tumor cell migration and proliferation. A specific polymorphism in the Urokinase gene may be associated with late onset Alzheimer disease and also with decreased affinity for fibrin binding. This protein converts plasminogen to plasmin by specific cleavage of an Arg Val bond in plasminogen. The proprotein is cleaved at a Lys Ile bond by plasmin to form a two chain derivative in which a single disulfide bond connects the amino terminal A chain to the catalytically active, carboxy terminal B chain. This two chain derivative is also called HMW uPA (high molecular weight uPA). HMW uPA can be further processed into LMW uPA (low molecular weight uPA) by cleavage of chain A into a short chain A (A1) and an amino terminal fragment. LMW uPA is proteolytically active but does not bind to the uPA receptor.

Product Categories/Family for anti-uPA antibody

Antibodies; Coagulation Factors

NCBI and Uniprot Product Information

• NCBI GI #: 34194099
• NCBI GeneID: 5328
• Molecular Weight: 46,908 Da
• NCBI Official Full Name: Homo sapiens plasminogen activator, urokinase, mRNA
• NCBI Official Synonym Full Names: plasminogen activator, urokinase
• NCBI Official Symbol: PLAU
• NCBI Official Synonym Symbols: ATF; QPD; UPA; URK; u-PA; BDPLT5
• NCBI Protein Information: urokinase-type plasminogen activator
• Protein Family: Urokinase-type plasminogen activator

NCBI Description

This gene encodes a secreted serine protease that converts plasminogen to plasmin. The encoded preproprotein is proteolytically processed to generate A and B polypeptide chains. These chains associate via a single disulfide bond to form the catalytically inactive high molecular weight urokinase-type plasminogen activator (HMW-uPA). HMW-uPA can be further processed into the catalytically active low molecular weight urokinase-type plasminogen activator (LMW-uPA). This low molecular weight form does not bind to the urokinase-type plasminogen activator receptor. Mutations in this gene may be associated with Quebec platelet disorder and late-onset Alzheimer's disease. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]