Mouse anti-Human UNC5C Monoclonal Antibody | anti-UNC5C antibody
UNC5C (Protein Unc-5 Homolog C, Netrin Receptor UNC5C, Protein Unc-5 Homolog 3, UNC5H3) APC
Gene Names
UNC5C; UNC5H3
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UNC5C; Monoclonal Antibody; UNC5C (Protein Unc-5 Homolog C; Netrin Receptor UNC5C; Protein Unc-5 Homolog 3; UNC5H3) APC; anti-UNC5C antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C9
Specificity
Recognizes human UNC5C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-UNC5C antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa498-597 from UNC5C (AAH41156)with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IKVYNTSGAVTPQDDLSEFTSKLSPQMTQSLLENEALSLKNQSLARQTDPSCTAFGSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMR
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-UNC5C antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
66,079 Da
NCBI Official Full Name
Homo sapiens unc-5 homolog C (C. elegans), mRNA
NCBI Official Synonym Full Names
unc-5 netrin receptor C
NCBI Official Symbol
UNC5C
NCBI Official Synonym Symbols
UNC5H3
NCBI Protein Information
netrin receptor UNC5C
Protein Family
NCBI Description
This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region. [provided by RefSeq, Jul 2008]
Research Articles on UNC5C
Similar Products
Product Notes
The UNC5C (Catalog #AAA6139772) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UNC5C (Protein Unc-5 Homolog C, Netrin Receptor UNC5C, Protein Unc-5 Homolog 3, UNC5H3) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UNC5C can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UNC5C for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UNC5C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
