Mouse anti-Human UHRF1 Monoclonal Antibody | anti-UHRF1 antibody

UHRF1 (Ubiquitin-like PHD and RING Finger Domain-containing Protein 1, Ubiquitin-like-containing PHD and RING Finger Domains Protein 1, hUHRF1, E3 Ubiquitin-protein Ligase UHRF1, Inverted CCAAT Box-binding Protein of 90kD, ICBP90, Nuclear Protein 95, NP9

Cat. Num. AAA6236023

• Gene Names: UHRF1; Np95; hNP95; ICBP90; RNF106; TDRD22; hUHRF1; huNp95
• Reactivity: Human
• Applications: Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: UHRF1; Monoclonal Antibody; UHRF1 (Ubiquitin-like PHD and RING Finger Domain-containing Protein 1; Ubiquitin-like-containing PHD and RING Finger Domains Protein 1; hUHRF1; E3 Ubiquitin-protein Ligase UHRF1; Inverted CCAAT Box-binding Protein of 90kD; ICBP90; Nuclear Protein 95; NP9; EC=6.3.2.-; anti-UHRF1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3A11
• Specificity: Recognizes human UHRF1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.

• Applicable Applications for anti-UHRF1 antibody: FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa694-794 from human UHRF1 (NP_037414) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR*
• Conjugate: MaxLight750
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Product Categories/Family for anti-UHRF1 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 115430233
• NCBI GeneID: 29128
• NCBI Accession #: NP_037414
• NCBI GenBank Nucleotide #: NM_013282
• UniProt Accession #: Q2HIX7; Q96T88
• Molecular Weight: 91kDa
• NCBI Official Full Name: E3 ubiquitin-protein ligase UHRF1 isoform 2
• NCBI Official Synonym Full Names: ubiquitin like with PHD and ring finger domains 1
• NCBI Official Symbol: UHRF1
• NCBI Official Synonym Symbols: Np95; hNP95; ICBP90; RNF106; TDRD22; hUHRF1; huNp95
• NCBI Protein Information: E3 ubiquitin-protein ligase UHRF1
• Protein Family: UHRF1-binding protein

NCBI Description

This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. It is regarded as a hub protein for the integration of epigenetic information. This gene is up-regulated in various cancers, and it is therefore considered to be a therapeutic target. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene exists on chromosome 12. [provided by RefSeq, Feb 2014]