Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human, Mouse UCKL1 Monoclonal Antibody | anti-UCKL1 antibody

UCKL1 (Uridine-cytidine Kinase-like 1, URKL1, F538)

Gene Names
UCKL1; UCK1L; URKL1; UCK1-LIKE
Reactivity
Human, Mouse
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
UCKL1; Monoclonal Antibody; UCKL1 (Uridine-cytidine Kinase-like 1; URKL1; F538); Anti -UCKL1 (Uridine-cytidine Kinase-like 1; anti-UCKL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
8D4
Specificity
Recognizes human UCKL1. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
EERELSVRAALASAHQCHPLPRTLSVLKSTPQVRGMHTIIRDKETSRDEFIFYSKRLMRLLIEHALSFLPFQDCVVQTPQGQDYAGKCYAGKQITGVSIL
Applicable Applications for anti-UCKL1 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa301-401 from human UCKL1 (NP_060329) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(UCKL1 monoclonal antibody, Western Blot analysis of UCKL1 expression in NIH/3T3.)

Western Blot (WB) (UCKL1 monoclonal antibody, Western Blot analysis of UCKL1 expression in NIH/3T3.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to UCKL1 on NIH/3T3 cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to UCKL1 on NIH/3T3 cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged UCKL1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UCKL1 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-UCKL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
61,141 Da
NCBI Official Full Name
UCKL1 protein
NCBI Official Synonym Full Names
uridine-cytidine kinase 1-like 1
NCBI Official Symbol
UCKL1
NCBI Official Synonym Symbols
UCK1L; URKL1; UCK1-LIKE
NCBI Protein Information
uridine-cytidine kinase-like 1; uridine kinase-like 1
UniProt Protein Name
Uridine-cytidine kinase-like 1
Protein Family
UniProt Gene Name
UCKL1
UniProt Synonym Gene Names
URKL1
UniProt Entry Name
UCKL1_HUMAN

NCBI Description

The protein encoded by this gene is a uridine kinase. Uridine kinases catalyze the phosphorylation of uridine to uridine monophosphate. This protein has been shown to bind to Epstein-Barr nuclear antigen 3 as well as natural killer lytic-associated molecule. Ubiquitination of this protein is enhanced by the presence of natural killer lytic-associated molecule. In addition, protein levels decrease in the presence of natural killer lytic-associated molecule, suggesting that association with natural killer lytic-associated molecule results in ubiquitination and subsequent degradation of this protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014]

Uniprot Description

Function: May contribute to UTP accumulation needed for blast transformation and proliferation. Ref.1

Catalytic activity: ATP + uridine = ADP + UMP.ATP + cytidine = ADP + CMP.

Pathway: Pyrimidine metabolism; CTP biosynthesis via salvage pathway; CTP from cytidine: step 1/3.Pyrimidine metabolism; UMP biosynthesis via salvage pathway; UMP from uridine: step 1/1.

Subunit structure: Interacts with RNF19B and EBV EBNA3. Ref.1 Ref.6

Subcellular location: Cytoplasm. Nucleus. Note: EBNA3 induces isoform 1 translocation to the nucleus, whereas it does change isoform 3 location. Ref.1

Tissue specificity: Ubiquitous. Ref.1

Post-translational modification: Ubiquitinated by RNF19B; which induces proteasomal degradation. Ref.6

Sequence similarities: Belongs to the uridine kinase family.

Research Articles on UCKL1

Similar Products

Product Notes

The UCKL1 uckl1 (Catalog #AAA647319) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UCKL1 (Uridine-cytidine Kinase-like 1, URKL1, F538) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's UCKL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the UCKL1 uckl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EERELSVRAA LASAHQCHPL PRTLSVLKST PQVRGMHTII RDKETSRDEF IFYSKRLMRL LIEHALSFLP FQDCVVQTPQ GQDYAGKCYA GKQITGVSIL. It is sometimes possible for the material contained within the vial of "UCKL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.