Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (UCHL3 monoclonal antibody Western Blot analysis of UCHL3 expression in PC-12)

Mouse anti-Human, Rat UCHL3 Monoclonal Antibody | anti-UCHL3 antibody

UCHL3 (Ubiquitin Carboxyl-terminal Hydrolase Isozyme L3, UCH-L3, Ubiquitin thioesterase L3) (PE)

Gene Names
UCHL3; UCH-L3
Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UCHL3; Monoclonal Antibody; UCHL3 (Ubiquitin Carboxyl-terminal Hydrolase Isozyme L3; UCH-L3; Ubiquitin thioesterase L3) (PE); EC=3.4.19.12; anti-UCHL3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E9
Specificity
Recognizes human UCHL3. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-UCHL3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa131-230 from human UCHL3 (NP_005993) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(UCHL3 monoclonal antibody Western Blot analysis of UCHL3 expression in PC-12)

Western Blot (WB) (UCHL3 monoclonal antibody Western Blot analysis of UCHL3 expression in PC-12)

Western Blot (WB)

(UCHL3 monoclonal antibody, Western Blot analysis of UCHL3 expression in K-562)

Western Blot (WB) (UCHL3 monoclonal antibody, Western Blot analysis of UCHL3 expression in K-562)

Testing Data

(Detection limit for recombinant GST tagged UCHL3 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UCHL3 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-UCHL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28.3kDa (250aa), confirmed by MALDI-TOF
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase isozyme L3 isoform 2
NCBI Official Synonym Full Names
ubiquitin C-terminal hydrolase L3
NCBI Official Symbol
UCHL3
NCBI Official Synonym Symbols
UCH-L3
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase isozyme L3
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase isozyme L3
UniProt Gene Name
UCHL3
UniProt Synonym Gene Names
UCH-L3
UniProt Entry Name
UCHL3_HUMAN

NCBI Description

The protein encoded by this gene is a member of the deubiquitinating enzyme family. Members of this family are proteases that catalyze the removal of ubiquitin from polypeptides and are divided into five classes, depending on the mechanism of catalysis. This protein may hydrolyze the ubiquitinyl-N-epsilon amide bond of ubiquitinated proteins to regenerate ubiquitin for another catalytic cycle. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Aug 2012]

Uniprot Description

UCHL3: Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8. Has a 10-fold preference for Arg and Lys at position P3. Deubiquitinates ENAC in apical compartments, thereby regulating apical membrane recycling. Indirectly increases the phosphorylation of IGFIR, AKT and FOXO1 and promotes insulin- signaling and insulin-induced adipogenesis. Required for stress- response retinal, skeletal muscle and germ cell maintenance. May be involved in working memory. Can hydrolyze UBB(+1), a mutated form of ubiquitin which is not effectively degraded by the proteasome and is associated with neurogenerative disorders. Preferentially binds diubiquitin; the interaction does not hydrolyze diubiquitin but, in vitro, inhibits the hydrolyzing activity on other substrates. Highly expressed in heart, skeletal muscle, and testis. Inhibited by monoubiquitin and diubiquitin. Belongs to the peptidase C12 family.

Protein type: Protease; EC 3.4.19.12; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 13q22.2

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: peptidase activity; ubiquitin binding; protein binding; ubiquitin-specific protease activity

Biological Process: ubiquitin-dependent protein catabolic process; protein catabolic process

Research Articles on UCHL3

Similar Products

Product Notes

The UCHL3 uchl3 (Catalog #AAA6160961) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UCHL3 (Ubiquitin Carboxyl-terminal Hydrolase Isozyme L3, UCH-L3, Ubiquitin thioesterase L3) (PE) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UCHL3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UCHL3 uchl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UCHL3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.