Mouse UBR1 Monoclonal Antibody | anti-UBR1 antibody

UBR1 (Ubiquitin Protein Ligase E3 Component n-recognin 1, JBS, MGC142065, MGC142067) (APC)

Cat. Num. AAA6169858

• Gene Names: UBR1; JBS
• Applications: Immunofluorescence
• Purity: Purified
• Synonyms: UBR1; Monoclonal Antibody; UBR1 (Ubiquitin Protein Ligase E3 Component n-recognin 1; JBS; MGC142065; MGC142067) (APC); Ubiquitin Protein Ligase E3 Component n-recognin 1; MGC142067; anti-UBR1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4G7
• Specificity: Recognizes UBR1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-UBR1 antibody: Immunofluorescence (IF)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: UBR1 (NP_777576, 2aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQLCG
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged UBR1 is 0.3 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to UBR1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to UBR1 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-UBR1 antibody

The N-end rule pathway is one proteolytic pathway of the ubiquitin system. The recognition component of this pathway, encoded by this gene, binds to a destabilizing N-terminal residue of a substrate protein and participates in the formation of a substrate-linked multiubiquitin chain. This leads to the eventual degradation of the substrate protein. The protein described in this record has a RING-type zinc finger and a UBR-type zinc finger. Mutations in this gene have been associated with Johanson-Blizzard syndrome. [provided by RefSeq]

Product Categories/Family for anti-UBR1 antibody

Antibodies; Ubiquitin Ligases

NCBI and Uniprot Product Information

• NCBI GI #: 28372497
• NCBI GeneID: 197131
• NCBI Accession #: NP_777576
• NCBI GenBank Nucleotide #: NM_174916
• UniProt Accession #: Q8IWV7
• Molecular Weight: 200kDa
• NCBI Official Full Name: E3 ubiquitin-protein ligase UBR1
• NCBI Official Synonym Full Names: ubiquitin protein ligase E3 component n-recognin 1
• NCBI Official Symbol: UBR1
• NCBI Official Synonym Symbols: JBS
• NCBI Protein Information: E3 ubiquitin-protein ligase UBR1
• UniProt Protein Name: E3 ubiquitin-protein ligase UBR1
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: UBR1
• UniProt Entry Name: UBR1_HUMAN

NCBI Description

The N-end rule pathway is one proteolytic pathway of the ubiquitin system. The recognition component of this pathway, encoded by this gene, binds to a destabilizing N-terminal residue of a substrate protein and participates in the formation of a substrate-linked multiubiquitin chain. This leads to the eventual degradation of the substrate protein. The protein described in this record has a RING-type zinc finger and a UBR-type zinc finger. Mutations in this gene have been associated with Johanson-Blizzard syndrome. [provided by RefSeq, Jul 2008]

Uniprot Description

UBR1: E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. May be involved in pancreatic homeostasis. Binds leucine and is a negative regulator of the leucine-mTOR signaling pathway, thereby controlling cell growth. Defects in UBR1 are a cause of Johanson-Blizzard syndrome (JBS). This disorder includes congenital exocrine pancreatic insufficiency, multiple malformations such as nasal wing aplasia, and frequent mental retardation. Pancreas of individuals with JBS do not express UBR1 and show intrauterine- onset destructive pancreatitis. Belongs to the UBR1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system; Ubiquitin ligase; EC 6.3.2.19; Ligase; EC 6.3.2.-

Chromosomal Location of Human Ortholog: 15q13

Cellular Component: proteasome complex; cytosol; ubiquitin ligase complex

Molecular Function: zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; negative regulation of TOR signaling pathway; protein ubiquitination

Disease: Johanson-blizzard Syndrome