Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.81kD).)

Mouse Ubiquilin-2 Monoclonal Antibody | anti-UBQLN2 antibody

Ubiquilin-2 (UBQLN2, Chap1, DSK2 Homolog, HRIHFB2157, N4BP4, Protein Linking IAP with Cytoskeleton 2, PLIC2, PLIC-2, hPLIC-2, Ubiquitin-like Product Chap1/Dsk2) (Biotin)

Gene Names
UBQLN2; DSK2; ALS15; CHAP1; N4BP4; PLIC2; HRIHFB2157
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Ubiquilin-2; Monoclonal Antibody; Ubiquilin-2 (UBQLN2; Chap1; DSK2 Homolog; HRIHFB2157; N4BP4; Protein Linking IAP with Cytoskeleton 2; PLIC2; PLIC-2; hPLIC-2; Ubiquitin-like Product Chap1/Dsk2) (Biotin); ALS15; DSK2; anti-UBQLN2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5F5
Specificity
Recognizes human UBQLN2. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-UBQLN2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa555-625 from human UBQLN2 (NP_038472) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.81kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.81kD).)

Western Blot (WB)

(UBQLN2 monoclonal antibody. Western Blot analysis of UBQLN2 expression in PC-12.)

Western Blot (WB) (UBQLN2 monoclonal antibody. Western Blot analysis of UBQLN2 expression in PC-12.)

Western Blot (WB)

(UBQLN2 monoclonal antibody. Western Blot analysis of UBQLN2 expression in Raw 264.7.)

Western Blot (WB) (UBQLN2 monoclonal antibody. Western Blot analysis of UBQLN2 expression in Raw 264.7.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to UBQLN2 on A-431 cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to UBQLN2 on A-431 cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged UBQLN2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UBQLN2 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(UBQLN2 monoclonal antibody, Western Blot analysis of UBQLN2 expression in A-431.)

Western Blot (WB) (UBQLN2 monoclonal antibody, Western Blot analysis of UBQLN2 expression in A-431.)

Western Blot (WB)

(UBQLN2 monoclonal antibody. Western Blot analysis of UBQLN2 expression in NIH/3T3.)

Western Blot (WB) (UBQLN2 monoclonal antibody. Western Blot analysis of UBQLN2 expression in NIH/3T3.)
Product Categories/Family for anti-UBQLN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68.1kDa (647aa)
NCBI Official Full Name
ubiquilin-2
NCBI Official Synonym Full Names
ubiquilin 2
NCBI Official Symbol
UBQLN2
NCBI Official Synonym Symbols
DSK2; ALS15; CHAP1; N4BP4; PLIC2; HRIHFB2157
NCBI Protein Information
ubiquilin-2
UniProt Protein Name
Ubiquilin-2
Protein Family
UniProt Gene Name
UBQLN2
UniProt Synonym Gene Names
N4BP4; PLIC2; PLIC-2; hPLIC-2
UniProt Entry Name
UBQL2_HUMAN

NCBI Description

This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases; and thus, are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to bind the ATPase domain of the Hsp70-like Stch protein. [provided by RefSeq, Oct 2009]

Uniprot Description

UBQLN2: Increases the half-life of proteins destined to be degraded by the proteasome; may modulate proteasome-mediated protein degradation. Defects in UBQLN2 are the cause of amyotrophic lateral sclerosis type 15 with or without frontotemporal dementia (ALS15). A neurodegenerative disorder affecting upper motor neurons in the brain and lower motor neurons in the brain stem and spinal cord, resulting in fatal paralysis. Sensory abnormalities are absent. The pathologic hallmarks of the disease include pallor of the corticospinal tract due to loss of motor neurons, presence of ubiquitin-positive inclusions within surviving motor neurons, and deposition of pathologic aggregates. The etiology of amyotrophic lateral sclerosis is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of the cases. Patients with ALS15 may develop frontotemporal dementia.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: Xp11.21

Cellular Component: cytoplasm; plasma membrane

Molecular Function: protein binding

Biological Process: ER-associated protein catabolic process; regulation of macroautophagy

Disease: Amyotrophic Lateral Sclerosis 15, With Or Without Frontotemporal Dementia

Research Articles on UBQLN2

Similar Products

Product Notes

The UBQLN2 ubqln2 (Catalog #AAA6145047) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Ubiquilin-2 (UBQLN2, Chap1, DSK2 Homolog, HRIHFB2157, N4BP4, Protein Linking IAP with Cytoskeleton 2, PLIC2, PLIC-2, hPLIC-2, Ubiquitin-like Product Chap1/Dsk2) (Biotin) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Ubiquilin-2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBQLN2 ubqln2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Ubiquilin-2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.