Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human, Mouse UBE4A Monoclonal Antibody | anti-UBE4A antibody

UBE4A (Ubiquitin Conjugation Factor E4 A, KIAA0126, UBOX2, UFD2) (FITC)

Gene Names
UBE4A; E4; UFD2; UBOX2
Reactivity
Human, Mouse
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBE4A; Monoclonal Antibody; UBE4A (Ubiquitin Conjugation Factor E4 A; KIAA0126; UBOX2; UFD2) (FITC); anti-UBE4A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G8
Specificity
Recognizes human UBE4A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
6109
Applicable Applications for anti-UBE4A antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa974-1073 from UBE4A (NP_004779) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LAERIKSLADLQQQEEETYADACDEFLDPIMSTLMCDPVVLPSSRVTVDRSTIARHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQKEQLE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(UBE4A monoclonal antibody Western Blot analysis of UBE4A expression in human colon.)

Western Blot (WB) (UBE4A monoclonal antibody Western Blot analysis of UBE4A expression in human colon.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to UBE4A on HeLa cell. [antibody concentration 10ug/ml.)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to UBE4A on HeLa cell. [antibody concentration 10ug/ml.)

Testing Data

(Detection limit for recombinant GST tagged UBE4A is ~3ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged UBE4A is ~3ng/ml as a capture antibody)
Product Categories/Family for anti-UBE4A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens ubiquitination factor E4A (UBE4A), transcript variant 1, mRNA
NCBI Official Synonym Full Names
ubiquitination factor E4A
NCBI Official Symbol
UBE4A
NCBI Official Synonym Symbols
E4; UFD2; UBOX2
NCBI Protein Information
ubiquitin conjugation factor E4 A
UniProt Protein Name
Ubiquitin conjugation factor E4 A
UniProt Gene Name
UBE4A
UniProt Entry Name
UBE4A_HUMAN

NCBI Description

This gene encodes a member of the U-box ubiquitin ligase family. The encoded protein is involved in multiubiquitin chain assembly and plays a critical role in chromosome condensation and separation through the polyubiquitination of securin. Autoantibodies against the encoded protein may be markers for scleroderma and Crohn's disease. A pseudogene of this gene is located on the long arm of chromosome 3. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2011]

Research Articles on UBE4A

Similar Products

Product Notes

The UBE4A ube4a (Catalog #AAA6150343) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBE4A (Ubiquitin Conjugation Factor E4 A, KIAA0126, UBOX2, UFD2) (FITC) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's UBE4A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBE4A ube4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBE4A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.