Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of UBE3A expression in Jurkat usingMBS6001456.)

Mouse anti-Human, Rat UBE3A Monoclonal Antibody | anti-UBE3A antibody

UBE3A (Ubiquitin-protein Ligase E3A, E6AP Ubiquitin-protein Ligase, Human Papillomavirus E6-associated Protein, HPVE6A, E6AP, EPVE6AP, Oncogenic Protein-associated Protein E6-AP, Renal Carcinoma Antigen NY-REN-54) (PE)

Gene Names
UBE3A; AS; ANCR; E6-AP; HPVE6A; EPVE6AP
Reactivity
Human, Rat
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBE3A; Monoclonal Antibody; UBE3A (Ubiquitin-protein Ligase E3A; E6AP Ubiquitin-protein Ligase; Human Papillomavirus E6-associated Protein; HPVE6A; E6AP; EPVE6AP; Oncogenic Protein-associated Protein E6-AP; Renal Carcinoma Antigen NY-REN-54) (PE); EC=6.3.2.-; AS; ANCR; E6-AP; anti-UBE3A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F6
Specificity
Recognizes human UBE3A. Species Crossreactivity: rat
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-UBE3A antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa51-150 from human UBE3A with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ETFQQLITYKVISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNKKGPRVDPLETELGVKTLDCR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of UBE3A expression in Jurkat usingMBS6001456.)

Western Blot (WB) (Western Blot analysis of UBE3A expression in Jurkat usingMBS6001456.)

Western Blot (WB)

(Western Blot detection against immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against immunogen (36.74kD).)

Immunohistochemistry (IHC)

(Immunohistochemistry of formalin-fixed paraffin-embedded human lung using MBS6001456 (3ug/ml).)

Immunohistochemistry (IHC) (Immunohistochemistry of formalin-fixed paraffin-embedded human lung using MBS6001456 (3ug/ml).)

Testing Data

(Detection limit for MBS6001456 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for MBS6001456 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-UBE3A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
100,688 Da
NCBI Official Full Name
Homo sapiens ubiquitin protein ligase E3A, mRNA
NCBI Official Synonym Full Names
ubiquitin protein ligase E3A
NCBI Official Symbol
UBE3A
NCBI Official Synonym Symbols
AS; ANCR; E6-AP; HPVE6A; EPVE6AP
NCBI Protein Information
ubiquitin-protein ligase E3A; CTCL tumor antigen se37-2; E6AP ubiquitin-protein ligase; renal carcinoma antigen NY-REN-54; human papillomavirus E6-associated protein; oncogenic protein-associated protein E6-AP; human papilloma virus E6-associated protein
UniProt Protein Name
Ubiquitin-protein ligase E3A
Protein Family
UniProt Gene Name
UBE3A
UniProt Synonym Gene Names
E6AP; EPVE6AP; HPVE6A
UniProt Entry Name
UBE3A_HUMAN

Similar Products

Product Notes

The UBE3A ube3a (Catalog #AAA6160948) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBE3A (Ubiquitin-protein Ligase E3A, E6AP Ubiquitin-protein Ligase, Human Papillomavirus E6-associated Protein, HPVE6A, E6AP, EPVE6AP, Oncogenic Protein-associated Protein E6-AP, Renal Carcinoma Antigen NY-REN-54) (PE) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UBE3A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBE3A ube3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBE3A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.