Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to UBE2U on HeLa cell. [antibody concentration 10ug/ml].)

Mouse anti-Human UBE2U Monoclonal Antibody | anti-UBE2U antibody

UBE2U (Ubiquitin-conjugating Enzyme E2 U, Ubiquitin Carrier Protein U, Ubiquitin-protein Ligase U, RP4-636O23.1) APC

Gene Names
TRIM69; Trif; HSD34; RNF36
Reactivity
Human
Applications
ELISA, Immunofluorescence
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBE2U; Monoclonal Antibody; UBE2U (Ubiquitin-conjugating Enzyme E2 U; Ubiquitin Carrier Protein U; Ubiquitin-protein Ligase U; RP4-636O23.1) APC; EC=6.3.2.19; anti-UBE2U antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D4
Specificity
Recognizes human UBE2U.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-UBE2U antibody
ELISA (EIA), Immunofluorescence (IF)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa9-103 from human UBE2U with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LHRDFCDLKENNYKGITAKPVSEDMMEWEVEIEGLQNSVWQGLVFQLTIHFTSEYNYAPPVVKFITIPFHPNVDPHTGQPCIDFLDNPEKWNTN
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to UBE2U on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to UBE2U on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged UBE2U is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UBE2U is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-UBE2U antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,419 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM69 isoform b
NCBI Official Synonym Full Names
tripartite motif containing 69
NCBI Official Symbol
TRIM69
NCBI Official Synonym Symbols
Trif; HSD34; RNF36
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM69; trimless; ring finger protein 36; tripartite motif protein 69; tripartite motif-containing 69; tripartite motif-containing protein 69; RFP-like domain-containing protein trimless
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM69
UniProt Gene Name
TRIM69
UniProt Synonym Gene Names
RNF36
UniProt Entry Name
TRI69_HUMAN

Uniprot Description

TRIM69: May play a role in apoptosis. Belongs to the TRIM/RBCC family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 15q21.1

Cellular Component: cytoplasm; plasma membrane; nuclear speck; nucleus

Molecular Function: zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: apoptosis; protein ubiquitination

Similar Products

Product Notes

The UBE2U trim69 (Catalog #AAA6139734) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBE2U (Ubiquitin-conjugating Enzyme E2 U, Ubiquitin Carrier Protein U, Ubiquitin-protein Ligase U, RP4-636O23.1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2U can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBE2U trim69 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBE2U, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.