Mouse anti-Human UBE2G2 Monoclonal Antibody | anti-UBE2G2 antibody

UBE2G2 (Ubiquitin-conjugating Enzyme E2 G2, Ubiquitin Carrier Protein G2, Ubiquitin-protein Ligase G2, UBC7) (Biotin)

Cat. Num. AAA6145024

• Gene Names: UBE2D1; SFT; UBCH5; UBC4/5; UBCH5A; E2(17)KB1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: UBE2G2; Monoclonal Antibody; UBE2G2 (Ubiquitin-conjugating Enzyme E2 G2; Ubiquitin Carrier Protein G2; Ubiquitin-protein Ligase G2; UBC7) (Biotin); EC=6.3.2.19; anti-UBE2G2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5E1
• Specificity: Recognizes human UBE2G2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-UBE2G2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-87 from human UBE2G2 (NP_003334.2) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGR
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(UBE2G2 monoclonal antibody, Western Blot analysis of UBE2G2 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of UBE2G2 expression in transfected 293T cell line by UBE2G2 monoclonal antibody. Lane 1: UBE2G2 transfected lysate (15.6KD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to UBE2G2 on formalin-fixed paraffin-embedded human liver. [antibody concentration 1ug/ml])

Testing Data

(Detection limit for recombinant GST tagged UBE2G2 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-UBE2G2 antibody

Antibodies; Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 4507773
• NCBI GeneID: 7321
• NCBI Accession #: NP_003329
• NCBI GenBank Nucleotide #: NM_003343
• UniProt Accession #: P51668; A6NLF6; A8K786
• Molecular Weight: 19.0 kDa (170aa), confirmed by MALDI-TOF
• NCBI Official Full Name: ubiquitin-conjugating enzyme E2 D1 isoform 1
• NCBI Official Synonym Full Names: ubiquitin conjugating enzyme E2 D1
• NCBI Official Symbol: UBE2D1
• NCBI Official Synonym Symbols: SFT; UBCH5; UBC4/5; UBCH5A; E2(17)KB1
• NCBI Protein Information: ubiquitin-conjugating enzyme E2 D1
• UniProt Protein Name: Ubiquitin-conjugating enzyme E2 D1
• Protein Family: Ubiquitin-conjugating enzyme
• UniProt Gene Name: UBE2D1
• UniProt Synonym Gene Names: SFT; UBC5A; UBCH5; UBCH5A; SFT
• UniProt Entry Name: UB2D1_HUMAN

NCBI Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]

Uniprot Description

UBE2D1: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys- 48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP- induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and auto-ubiquitination of STUB1, TRAF6 and TRIM63/MURF1. Ubiquitinates STUB1-associated HSP90AB1 in vitro. Lacks inherent specificity for any particular lysine residue of ubiquitin. Essential for viral activation of IRF3. Mediates polyubiquitination of CYP3A4. Belongs to the ubiquitin-conjugating enzyme family.

Protein type: Ubiquitin conjugating system; EC 6.3.2.19; Ubiquitin ligase; Ligase

Chromosomal Location of Human Ortholog: 10q21.1

Cellular Component: nucleoplasm; protein complex; cytoplasm; cytosol; ubiquitin ligase complex

Molecular Function: protein binding; ubiquitin-protein ligase activity; ATP binding; ligase activity

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; ubiquitin-dependent protein catabolic process; transcription initiation from RNA polymerase II promoter; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; protein polyubiquitination; transcription, DNA-dependent; MyD88-independent toll-like receptor signaling pathway; toll-like receptor 3 signaling pathway; negative regulation of transcription from RNA polymerase II promoter; BMP signaling pathway; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; positive regulation of protein ubiquitination; transforming growth factor beta receptor signaling pathway; mitotic cell cycle spindle assembly checkpoint; toll-like receptor signaling pathway; innate immune response; gene expression; mitotic cell cycle; toll-like receptor 4 signaling pathway