Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (UBE2D3 monoclonal antibody, Western Blot analysis of UBE2D3 expression in Jurkat.)

Mouse anti-Human UBE2D3 Monoclonal Antibody | anti-UBE2D3 antibody

UBE2D3 (Ubiquitin-conjugating Enzyme E2 D3, UBC5C, UBCH5C, Ubiquitin Carrier Protein D3, Ubiquitin-conjugating Enzyme E2(17)KB 3, Ubiquitin-conjugating Enzyme E2-17kD 3, Ubiquitin-protein Ligase D3) (Biotin)

Gene Names
UBE2D3; UBC4/5; UBCH5C; E2(17)KB3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBE2D3; Monoclonal Antibody; UBE2D3 (Ubiquitin-conjugating Enzyme E2 D3; UBC5C; UBCH5C; Ubiquitin Carrier Protein D3; Ubiquitin-conjugating Enzyme E2(17)KB 3; Ubiquitin-conjugating Enzyme E2-17kD 3; Ubiquitin-protein Ligase D3) (Biotin); EC=6.3.2.19; UBC4/5; E2(17)KB3; anti-UBE2D3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4C1-1E3
Specificity
Recognizes human UBE2D3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-UBE2D3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
ELISA: 1ng/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-147 from human UBE2D3 (AAH03395) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(UBE2D3 monoclonal antibody, Western Blot analysis of UBE2D3 expression in Jurkat.)

Western Blot (WB) (UBE2D3 monoclonal antibody, Western Blot analysis of UBE2D3 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of UBE2D3 expression in transfected 293T cell line by UBE2D3 monoclonal antibody. Lane 1: UBE2D3 transfected lysate (16.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of UBE2D3 expression in transfected 293T cell line by UBE2D3 monoclonal antibody. Lane 1: UBE2D3 transfected lysate (16.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged UBE2D3 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UBE2D3 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-UBE2D3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
16,893 Da
NCBI Official Full Name
Homo sapiens ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast), mRNA
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 D3
NCBI Official Symbol
UBE2D3
NCBI Official Synonym Symbols
UBC4/5; UBCH5C; E2(17)KB3
NCBI Protein Information
ubiquitin-conjugating enzyme E2 D3

NCBI Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Multiple spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined. [provided by RefSeq, Jul 2008]

Research Articles on UBE2D3

Similar Products

Product Notes

The UBE2D3 (Catalog #AAA6145020) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBE2D3 (Ubiquitin-conjugating Enzyme E2 D3, UBC5C, UBCH5C, Ubiquitin Carrier Protein D3, Ubiquitin-conjugating Enzyme E2(17)KB 3, Ubiquitin-conjugating Enzyme E2-17kD 3, Ubiquitin-protein Ligase D3) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2D3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). ELISA: 1ng/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBE2D3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBE2D3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.