Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse UBE2D2 Monoclonal Antibody | anti-UBE2D2 antibody

UBE2D2 (Ubiquitin-conjugating Enzyme E2 D2, UBC4, UBC5B, UBCH4, UBCH5B, Ubiquitin Carrier Protein D2, Ubiquitin-conjugating Enzyme E2(17)KB 2, Ubiquitin-conjugating Enzyme E2-17kD 2, Ubiquitin-protein Ligase D2, p53-regulated Ubiquitin-conjugating Enzyme

Gene Names
UBE2D2; UBC4; PUBC1; UBCH4; UBC4/5; UBCH5B; E2(17)KB2
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBE2D2; Monoclonal Antibody; UBE2D2 (Ubiquitin-conjugating Enzyme E2 D2; UBC4; UBC5B; UBCH4; UBCH5B; Ubiquitin Carrier Protein D2; Ubiquitin-conjugating Enzyme E2(17)KB 2; Ubiquitin-conjugating Enzyme E2-17kD 2; Ubiquitin-protein Ligase D2; p53-regulated Ubiquitin-conjugating Enzyme; EC=6.3.2.19; UBC4/5; E2(17)KB2; anti-UBE2D2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A1
Specificity
Recognizes human UBE2D2. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-UBE2D2 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-94 from human UBE2D2 (NP_003330) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWS
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-UBE2D2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18.9 kDa (167aa), confirmed by MALDI-TOF
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 D2 isoform 1
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 D2
NCBI Official Symbol
UBE2D2
NCBI Official Synonym Symbols
UBC4; PUBC1; UBCH4; UBC4/5; UBCH5B; E2(17)KB2
NCBI Protein Information
ubiquitin-conjugating enzyme E2 D2
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 D2
UniProt Gene Name
UBE2D2
UniProt Synonym Gene Names
PUBC1; UBC4; UBC5B; UBCH4; UBCH5B
UniProt Entry Name
UB2D2_HUMAN

NCBI Description

Regulated degradation of misfolded, damaged or short-lived proteins in eukaryotes occurs via the ubiquitin (Ub)-proteasome system (UPS). An integral part of the UPS system is the ubiquitination of target proteins and covalent linkage of Ub-containing proteins to form polymeric chains, marking them as targets for 26S proteasome-mediated degradation. Ubiquitination of proteins is mediated by a cascade of enzymes which includes E1 (ubiquitin activating), E2 (ubiquitin conjugating), and E3 (ubiquitin ligases) enzymes. This gene encodes a member of the E2 enzyme family. Substrates of this enzyme include the tumor suppressor protein p53 and peroxisomal biogenesis factor 5 (PEX5). Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]

Uniprot Description

UBE2D2: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys- 48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP- induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and autoubiquitination of STUB1 and TRAF6. Involved in the signal-induced conjugation and subsequent degradation of NFKBIA, FBXW2-mediated GCM1 ubiquitination and degradation, MDM2-dependent degradation of p53/TP53 and the activation of MAVS in the mitochondria by DDX58/RIG-I in response to viral infection. Essential for viral activation of IRF3. Belongs to the ubiquitin-conjugating enzyme family.

Protein type: Ubiquitin conjugating system; Ligase; Ubiquitin ligase; EC 6.3.2.19

Chromosomal Location of Human Ortholog: 5q31.2

Cellular Component: nucleoplasm; protein complex; cytosol; ubiquitin ligase complex

Molecular Function: protein binding; ubiquitin-protein ligase activity; ATP binding; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; protein polyubiquitination; MyD88-independent toll-like receptor signaling pathway; toll-like receptor signaling pathway; innate immune response; protein modification process; protein ubiquitination; toll-like receptor 3 signaling pathway; toll-like receptor 4 signaling pathway

Research Articles on UBE2D2

Similar Products

Product Notes

The UBE2D2 ube2d2 (Catalog #AAA6203952) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBE2D2 (Ubiquitin-conjugating Enzyme E2 D2, UBC4, UBC5B, UBCH4, UBCH5B, Ubiquitin Carrier Protein D2, Ubiquitin-conjugating Enzyme E2(17)KB 2, Ubiquitin-conjugating Enzyme E2-17kD 2, Ubiquitin-protein Ligase D2, p53-regulated Ubiquitin-conjugating Enzyme reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2D2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBE2D2 ube2d2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBE2D2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.