Mouse anti-Human UBE2C Monoclonal Antibody | anti-UBE2C antibody

UBE2C (Ubiquitin-conjugating Enzyme E2 C, UbcH10, Ubiquitin Carrier Protein C, Ubiquitin-protein Ligase C, dJ447F3.2) (FITC)

Cat. Num. AAA6150320

• Gene Names: UBE2C; UBCH10; dJ447F3.2
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: UBE2C; Monoclonal Antibody; UBE2C (Ubiquitin-conjugating Enzyme E2 C; UbcH10; Ubiquitin Carrier Protein C; Ubiquitin-protein Ligase C; dJ447F3.2) (FITC); EC=6.3.2.19; anti-UBE2C antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 9D3
• Specificity: Recognizes human UBE2C.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-UBE2C antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa70-180 from human UBE2C (NP_008950) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(UBE2C monoclonal antibody, Western Blot analysis of UBE2C expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of UBE2C expression in transfected 293T cell line by UBE2C monoclonal antibody. Lane 1: UBE2C transfected lysate (19.7kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to UBE2C on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to UBE2C on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged UBE2C is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-UBE2C antibody

Antibodies; Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 5902146
• NCBI GeneID: 11065
• NCBI Accession #: NP_008950
• NCBI GenBank Nucleotide #: NM_007019
• UniProt Accession #: O00762; A6NP33; E1P5N7; G3XAB7
• Molecular Weight: 22.1 kDa (202aa), confirmed by MALDI-TOF
• NCBI Official Full Name: ubiquitin-conjugating enzyme E2 C isoform 1
• NCBI Official Synonym Full Names: ubiquitin conjugating enzyme E2 C
• NCBI Official Symbol: UBE2C
• NCBI Official Synonym Symbols: UBCH10; dJ447F3.2
• NCBI Protein Information: ubiquitin-conjugating enzyme E2 C
• UniProt Protein Name: Ubiquitin-conjugating enzyme E2 C
• Protein Family: Ubiquitin-conjugating enzyme
• UniProt Gene Name: UBE2C
• UniProt Synonym Gene Names: UBCH10
• UniProt Entry Name: UBE2C_HUMAN

NCBI Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been defined on chromosomes 4, 14, 15, 18, and 19. [provided by RefSeq, Aug 2013]

Uniprot Description

UBE2C: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys- 11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit. Belongs to the ubiquitin-conjugating enzyme family.

Protein type: Ubiquitin conjugating system; Ligase; Cell cycle regulation; EC 6.3.2.19; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 20q13.12

Cellular Component: nucleoplasm; anaphase-promoting complex; cytoplasm; cytosol

Molecular Function: protein binding; small conjugating protein ligase activity; ubiquitin protein ligase binding; ubiquitin-protein ligase activity; ATP binding; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; regulation of mitotic metaphase/anaphase transition; protein ubiquitination; cyclin catabolic process; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex activation; cell division; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; mitotic cell cycle spindle assembly checkpoint; mitotic cell cycle; exit from mitosis; positive regulation of exit from mitosis