Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse U2AF2 Monoclonal Antibody | anti-U2AF2 antibody

U2AF2 (U2 Small Nuclear RNA Auxiliary Factor 2, U2AF65) (MaxLight 405)

Gene Names
U2AF2; U2AF65
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
U2AF2; Monoclonal Antibody; U2AF2 (U2 Small Nuclear RNA Auxiliary Factor 2; U2AF65) (MaxLight 405); U2 Small Nuclear RNA Auxiliary Factor 2; U2AF65; anti-U2AF2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5G8
Specificity
Recognizes U2AF2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-U2AF2 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
U2AF2 (NP_001012496.1, 141aa-240aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSE
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-U2AF2 antibody
U2 auxiliary factor (U2AF), comprised of a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the U2AF large subunit which contains a sequence-specific RNA-binding region with 3 RNA recognition motifs and an Arg/Ser-rich domain necessary for splicing. The large subunit binds to the polypyrimidine tract of introns early during spliceosome assembly. Multiple transcript variants have been detected for this gene, but the full-length natures of only two have been determined to date. [provided by RefSeq]
Product Categories/Family for anti-U2AF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,501 Da
NCBI Official Full Name
splicing factor U2AF 65 kDa subunit isoform b
NCBI Official Synonym Full Names
U2 small nuclear RNA auxiliary factor 2
NCBI Official Symbol
U2AF2
NCBI Official Synonym Symbols
U2AF65
NCBI Protein Information
splicing factor U2AF 65 kDa subunit; hU2AF65; U2 auxiliary factor 65 kDa subunit; U2 snRNP auxiliary factor large subunit; U2 (RNU2) small nuclear RNA auxiliary factor 2; U2 small nuclear ribonucleoprotein auxiliary factor (65kD)
UniProt Protein Name
Splicing factor U2AF 65 kDa subunit
Protein Family
UniProt Gene Name
U2AF2
UniProt Synonym Gene Names
U2AF65; hU2AF(65); hU2AF65
UniProt Entry Name
U2AF2_HUMAN

Uniprot Description

U2AF2: Necessary for the splicing of pre-mRNA. Induces cardiac troponin-T (TNNT2) pre-mRNA exon inclusion in muscle. Regulates the TNNT2 exon 5 inclusion through competition with MBNL1. Binds preferentially to a single-stranded structure within the polypyrimidine tract of TNNT2 intron 4 during spliceosome assembly. Required for the export of mRNA out of the nucleus, even if the mRNA is encoded by an intron-less gene. Represses the splicing of MAPT/Tau exon 10. Belongs to the splicing factor SR family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; Spliceosome; RNA splicing

Chromosomal Location of Human Ortholog: 19q13.42

Cellular Component: nucleoplasm; spliceosome; nuclear speck

Molecular Function: protein binding; enzyme binding; nucleotide binding

Biological Process: transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome; mRNA export from nucleus; negative regulation of nuclear mRNA splicing, via spliceosome; RNA splicing; gene expression; mRNA 3'-end processing; mRNA processing; termination of RNA polymerase II transcription; positive regulation of RNA splicing

Similar Products

Product Notes

The U2AF2 u2af2 (Catalog #AAA6198554) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's U2AF2 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the U2AF2 u2af2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "U2AF2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.