Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ZRSR2 is 0.1ng/ml as a capture antibody.)

Mouse anti-Human U2AF1RS2 Monoclonal Antibody | anti-ZRSR2 antibody

U2AF1RS2 (U2 Small Nuclear Ribonucleoprotein Auxiliary Factor 35 kDa Subunit-related Protein 2, U2AF1-RS2, CCCH Type Zinc Finger, RNA-binding Motif and Serine/arginine Rich Protein 2, ZRSR2, Renal Carcinoma Antigen NY-REN-20, U2(RNU2) Small Nuclear RNA Au

Gene Names
ZRSR2; URP; U2AF1L2; U2AF1RS2; U2AF1-RS2
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
U2AF1RS2; Monoclonal Antibody; U2AF1RS2 (U2 Small Nuclear Ribonucleoprotein Auxiliary Factor 35 kDa Subunit-related Protein 2; U2AF1-RS2; CCCH Type Zinc Finger; RNA-binding Motif and Serine/arginine Rich Protein 2; ZRSR2; Renal Carcinoma Antigen NY-REN-20; U2(RNU2) Small Nuclear RNA Au; Anti -U2AF1RS2 (U2 Small Nuclear Ribonucleoprotein Auxiliary Factor 35 kDa Subunit-related Protein 2; anti-ZRSR2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H5
Specificity
Recognizes human U2AF1L2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
GRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNG*
Applicable Applications for anti-ZRSR2 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa294-394 from U2AF1L2 (NP_005080) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ZRSR2 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZRSR2 is 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-ZRSR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,045 Da
NCBI Official Full Name
U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2
NCBI Official Synonym Full Names
zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2
NCBI Official Symbol
ZRSR2
NCBI Official Synonym Symbols
URP; U2AF1L2; U2AF1RS2; U2AF1-RS2
NCBI Protein Information
U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2; U2AF35-related protein; renal carcinoma antigen NY-REN-20; U2(RNU2) small nuclear RNA auxiliary factor 1-like 2; U2 small nuclear ribonucleoprotein auxiliary factor, small subunit 2
UniProt Protein Name
U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2
UniProt Gene Name
ZRSR2
UniProt Synonym Gene Names
U2AF1-RS2; U2AF1L2; U2AF1RS2; URP; URP
UniProt Entry Name
U2AFM_HUMAN

NCBI Description

This gene encodes an essential splicing factor. The encoded protein associates with the U2 auxiliary factor heterodimer, which is required for the recognition of a functional 3' splice site in pre-mRNA splicing, and may play a role in network interactions during spliceosome assembly. [provided by RefSeq, Jul 2008]

Uniprot Description

ZRSR2: Pre-mRNA-binding protein required for splicing of both U2- and U12-type introns. Selectively interacts with the 3'-splice site of U2- and U12-type pre-mRNAs and promotes different steps in U2 and U12 intron splicing. Recruited to U12 pre-mRNAs in an ATP- dependent manner and is required for assembly of the prespliceosome, a precursor to other spliceosomal complexes. For U2-type introns, it is selectively and specifically required for the second step of splicing.

Protein type: RNA splicing

Chromosomal Location of Human Ortholog: Xp22.1

Cellular Component: U12-dependent spliceosome

Molecular Function: protein binding; metal ion binding; nucleotide binding; pre-mRNA 3'-splice site binding

Biological Process: nuclear mRNA splicing, via spliceosome; RNA splicing; spliceosome assembly

Research Articles on ZRSR2

Similar Products

Product Notes

The ZRSR2 zrsr2 (Catalog #AAA6007769) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The U2AF1RS2 (U2 Small Nuclear Ribonucleoprotein Auxiliary Factor 35 kDa Subunit-related Protein 2, U2AF1-RS2, CCCH Type Zinc Finger, RNA-binding Motif and Serine/arginine Rich Protein 2, ZRSR2, Renal Carcinoma Antigen NY-REN-20, U2(RNU2) Small Nuclear RNA Au reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's U2AF1RS2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the ZRSR2 zrsr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GRQLQCEFCP VTRWKMAICG LFEIQQCPRG KHCNFLHVFR NPNNEFWEAN RDIYLSPDRT GSSFGKNSER RERMGHHDDY YSRLRGRRNP SPDHSYKRNG *. It is sometimes possible for the material contained within the vial of "U2AF1RS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.