Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Mouse anti-Human U2AF1 Monoclonal Antibody | anti-U2AF1 antibody

U2AF1 (U2 Small Nuclear RNA Auxiliary Factor 1, FP793, Splicing Factor U2AF 35kD Subunit, U2 Auxiliary Factor 35kD Subunit, U2AF35, U2 snRNP Auxiliary Factor Small Subunit, U2AFBP) APC

Gene Names
U2AF1; RN; FP793; U2AF35; U2AFBP; RNU2AF1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
U2AF1; Monoclonal Antibody; U2AF1 (U2 Small Nuclear RNA Auxiliary Factor 1; FP793; Splicing Factor U2AF 35kD Subunit; U2 Auxiliary Factor 35kD Subunit; U2AF35; U2 snRNP Auxiliary Factor Small Subunit; U2AFBP) APC; RN; RNU2AF1; anti-U2AF1 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C8
Specificity
Recognizes human U2AF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
240
Applicable Applications for anti-U2AF1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa56-155 from human U2AF1 (NP_006749) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACC
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged U2AF1 is 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-U2AF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
splicing factor U2AF 35 kDa subunit isoform a
NCBI Official Synonym Full Names
U2 small nuclear RNA auxiliary factor 1
NCBI Official Symbol
U2AF1
NCBI Official Synonym Symbols
RN; FP793; U2AF35; U2AFBP; RNU2AF1
NCBI Protein Information
splicing factor U2AF 35 kDa subunit
Protein Family

NCBI Description

This gene belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the small subunit which plays a critical role in both constitutive and enhancer-dependent RNA splicing by directly mediating interactions between the large subunit and proteins bound to the enhancers. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Research Articles on U2AF1

Similar Products

Product Notes

The U2AF1 (Catalog #AAA6139706) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The U2AF1 (U2 Small Nuclear RNA Auxiliary Factor 1, FP793, Splicing Factor U2AF 35kD Subunit, U2 Auxiliary Factor 35kD Subunit, U2AF35, U2 snRNP Auxiliary Factor Small Subunit, U2AFBP) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's U2AF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the U2AF1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "U2AF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual