Mouse TYK2 Monoclonal Antibody | anti-TYK2 antibody

TYK2 (Tyrosine Kinase 2, JTK1) (Biotin)

Cat. Num. AAA6171118

• Gene Names: TYK2; JTK1; IMD35
• Applications: Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: TYK2; Monoclonal Antibody; TYK2 (Tyrosine Kinase 2; JTK1) (Biotin); Tyrosine Kinase 2; JTK1; anti-TYK2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6H1
• Specificity: Recognizes TYK2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1187

• Applicable Applications for anti-TYK2 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TYK2 (AAH14243, 276aa-375aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAFGQPADRPREPLWA
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml])

Western Blot (WB)

(TYK2 monoclonal antibody (M03), clone 6H1 Western Blot analysis of TYK2 expression in Hela S3 NE.)

Testing Data

(Detection limit for recombinant GST tagged TYK2 is approximately 1ng/ml as a capture antibody.)

Related Product Information for anti-TYK2 antibody

This gene encodes a member of the tyrosine kinase and, more specifically, the Janus kinases (JAKs) protein families. This protein associates with the cytoplasmic domain of type I and type II cytokine receptors and promulgate cytokine signals by phosphorylating receptor subunits. It is also component of both the type I and type III interferon signaling pathways. As such, it may play a role in anti-viral immunity. A mutation in this gene has been associated with hyperimmunoglobulin E syndrome (HIES) - a primary immunodeficiency characterized by elevated serum immunoglobulin E. [provided by RefSeq]

Product Categories/Family for anti-TYK2 antibody

Antibodies; Tyrosine Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 15559784
• NCBI GeneID: 7297
• NCBI Official Full Name: Tyrosine kinase 2
• NCBI Official Synonym Full Names: tyrosine kinase 2
• NCBI Official Symbol: TYK2
• NCBI Official Synonym Symbols: JTK1; IMD35
• NCBI Protein Information: non-receptor tyrosine-protein kinase TYK2
• Protein Family: Non-receptor tyrosine-protein kinase

NCBI Description

This gene encodes a member of the tyrosine kinase and, more specifically, the Janus kinases (JAKs) protein families. This protein associates with the cytoplasmic domain of type I and type II cytokine receptors and promulgate cytokine signals by phosphorylating receptor subunits. It is also component of both the type I and type III interferon signaling pathways. As such, it may play a role in anti-viral immunity. A mutation in this gene has been associated with hyperimmunoglobulin E syndrome (HIES) - a primary immunodeficiency characterized by elevated serum immunoglobulin E. [provided by RefSeq, Jul 2008]