Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged TWIST1 is 1 ng/ml as a capture antibody.)

Mouse TWIST1 Monoclonal Antibody | anti-TWIST1 antibody

TWIST1 (Twist Homolog 1 (Drosophila), ACS3, BPES2, BPES3, SCS, Twist, bHLHa38) (PE)

Gene Names
TWIST1; CRS; CSO; SCS; ACS3; CRS1; BPES2; BPES3; TWIST; bHLHa38
Applications
Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
TWIST1; Monoclonal Antibody; TWIST1 (Twist Homolog 1 (Drosophila); ACS3; BPES2; BPES3; SCS; Twist; bHLHa38) (PE); Twist Homolog 1 (Drosophila); bHLHa38; anti-TWIST1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H5
Specificity
Recognizes TWIST1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-TWIST1 antibody
Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TWIST1 (NP_000465.1, 106aa-174aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMAS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TWIST1 is 1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TWIST1 is 1 ng/ml as a capture antibody.)

Immunoprecipitation (IP)

(Immunoprecipitation of TWIST1 transfected lysate using anti-TWIST1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TWIST1 MaxPab rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of TWIST1 transfected lysate using anti-TWIST1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TWIST1 MaxPab rabbit polyclonal antibody.)
Related Product Information for anti-TWIST1 antibody
Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. The protein encoded by this gene is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome. [provided by RefSeq]
Product Categories/Family for anti-TWIST1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
20,954 Da
NCBI Official Full Name
Homo sapiens twist family bHLH transcription factor 1 (TWIST1), mRNA
NCBI Official Synonym Full Names
twist family bHLH transcription factor 1
NCBI Official Symbol
TWIST1
NCBI Official Synonym Symbols
CRS; CSO; SCS; ACS3; CRS1; BPES2; BPES3; TWIST; bHLHa38
NCBI Protein Information
twist-related protein 1; B-HLH DNA binding protein; H-twist; TWIST homolog of drosophila; class A basic helix-loop-helix protein 38; twist basic helix-loop-helix transcription factor 1; twist homolog 1
Protein Family

NCBI Description

Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. The protein encoded by this gene is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome. [provided by RefSeq, Jul 2008]

Research Articles on TWIST1

Similar Products

Product Notes

The TWIST1 (Catalog #AAA6185497) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TWIST1 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TWIST1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TWIST1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.