Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Tumor Protein 63 Monoclonal Antibody | anti-TP63 antibody

Tumor Protein 63 (TP63, p63, Chronic Ulcerative Stomatitis Protein, CUSP, Keratinocyte Transcription Factor KET, Transformation-related Protein 63, Tumor Protein p73-like, p73L, TP73L, p40, p51, KET, P73H) (MaxLight 650)

Gene Names
TP63; AIS; KET; LMS; NBP; RHS; p40; p51; p63; EEC3; OFC8; p73H; p73L; SHFM4; TP53L; TP73L; p53CP; TP53CP; B(p51A); B(p51B)
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Tumor Protein 63; Monoclonal Antibody; Tumor Protein 63 (TP63; p63; Chronic Ulcerative Stomatitis Protein; CUSP; Keratinocyte Transcription Factor KET; Transformation-related Protein 63; Tumor Protein p73-like; p73L; TP73L; p40; p51; KET; P73H) (MaxLight 650); AIS; B(p51A); B(p51B); EEC3; LMS; OFC8; NBP; p53CP; RHS; SHFM4; TP53CP; TP53L; anti-TP63 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C2
Specificity
Recognizes human TP63.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-TP63 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from TP63 (AAH39815) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQD
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TP63 antibody
MaxLight650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor647, DyLight649, Cy5 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
Product Categories/Family for anti-TP63 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
65,288 Da
NCBI Official Full Name
Homo sapiens tumor protein p63, mRNA
NCBI Official Synonym Full Names
tumor protein p63
NCBI Official Symbol
TP63
NCBI Official Synonym Symbols
AIS; KET; LMS; NBP; RHS; p40; p51; p63; EEC3; OFC8; p73H; p73L; SHFM4; TP53L; TP73L; p53CP; TP53CP; B(p51A); B(p51B)
NCBI Protein Information
tumor protein 63
UniProt Protein Name
Tumor protein 63
Protein Family
UniProt Gene Name
TP63
UniProt Synonym Gene Names
KET; P63; P73H; P73L; TP73L; p63; CUSP; TP63; p73L
UniProt Entry Name
P63_HUMAN

NCBI Description

This gene encodes a member of the p53 family of transcription factors. The functional domains of p53 family proteins include an N-terminal transactivation domain, a central DNA-binding domain and an oligomerization domain. Alternative splicing of this gene and the use of alternative promoters results in multiple transcript variants encoding different isoforms that vary in their functional properties. These isoforms function during skin development and maintenance, adult stem/progenitor cell regulation, heart development and premature aging. Some isoforms have been found to protect the germline by eliminating oocytes or testicular germ cells that have suffered DNA damage. Mutations in this gene are associated with ectodermal dysplasia, and cleft lip/palate syndrome 3 (EEC3); split-hand/foot malformation 4 (SHFM4); ankyloblepharon-ectodermal defects-cleft lip/palate; ADULT syndrome (acro-dermato-ungual-lacrimal-tooth); limb-mammary syndrome; Rap-Hodgkin syndrome (RHS); and orofacial cleft 8. [provided by RefSeq, Aug 2016]

Uniprot Description

p63: Acts as a sequence specific DNA binding transcriptional activator or repressor. The isoforms contain a varying set of transactivation and auto-regulating transactivation inhibiting domains thus showing an isoform specific activity. Isoform 2 activates RIPK4 transcription. May be required in conjunction with TP73/p73 for initiation of p53/TP53 dependent apoptosis in response to genotoxic insults and the presence of activated oncogenes. Involved in Notch signaling by probably inducing JAG1 and JAG2. Plays a role in the regulation of epithelial morphogenesis. The ratio of DeltaN-type and TA*-type isoforms may govern the maintenance of epithelial stem cell compartments and regulate the initiation of epithelial stratification from the undifferentiated embryonal ectoderm. Required for limb formation from the apical ectodermal ridge. Activates transcription of the p21 promoter. Binds DNA as a homotetramer. Isoform composition of the tetramer may determine transactivation activity. Isoforms Alpha and Gamma interact with HIPK2. Interacts with SSRP1, leading to stimulate coactivator activity. Isoform 1 and isoform 2 interact with WWP1. Interacts with PDS5A. Isoform 5 (via activation domain) interacts with NOC2L. Widely expressed, notably in heart, kidney, placenta, prostate, skeletal muscle, testis and thymus, although the precise isoform varies according to tissue type. Progenitor cell layers of skin, breast, eye and prostate express high levels of DeltaN-type isoforms. Isoform 10 is predominantly expressed in skin squamous cell carcinomas, but not in normal skin tissues. Belongs to the p53 family. 12 isoforms of the human protein are produced by alternative promoter.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 3q28

Cellular Component: nucleoplasm; transcription factor complex; rough endoplasmic reticulum; dendrite; cytoplasm; nuclear chromatin; cytosol; nucleus; chromatin

Molecular Function: identical protein binding; protein binding; DNA binding; p53 binding; sequence-specific DNA binding; metal ion binding; double-stranded DNA binding; WW domain binding; damaged DNA binding; chromatin binding; transcription factor activity

Biological Process: G1 DNA damage checkpoint; ectoderm and mesoderm interaction; apoptosis; positive regulation of transcription, DNA-dependent; cloacal septation; epidermal cell division; negative regulation of transcription from RNA polymerase II promoter; regulation of caspase activity; protein homotetramerization; smooth muscle development; polarized epithelial cell differentiation; DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator; sympathetic nervous system development; regulation of neuron apoptosis; positive regulation of mesenchymal cell proliferation; epithelial cell development; response to gamma radiation; establishment of planar polarity; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; skeletal development; female genitalia morphogenesis; proximal/distal pattern formation; positive regulation of Notch signaling pathway; embryonic limb morphogenesis; response to X-ray; regulation of epidermal cell division; Notch signaling pathway; hair follicle morphogenesis; transcription, DNA-dependent; urinary bladder development; negative regulation of keratinocyte differentiation; multicellular organismal aging; keratinocyte proliferation; replicative cell aging; odontogenesis of dentine-containing teeth; keratinocyte differentiation; chromatin remodeling; positive regulation of osteoblast differentiation; neuron apoptosis; positive regulation of transcription from RNA polymerase II promoter; spermatogenesis; negative regulation of transcription, DNA-dependent; response to DNA damage stimulus; negative regulation of apoptosis

Disease: Ankyloblepharon-ectodermal Defects-cleft Lip/palate; Rapp-hodgkin Syndrome; Adult Syndrome; Ectrodactyly, Ectodermal Dysplasia, And Cleft Lip/palate Syndrome 3; Split-hand/foot Malformation 4; Limb-mammary Syndrome

Research Articles on TP63

Similar Products

Product Notes

The TP63 tp63 (Catalog #AAA6225165) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Tumor Protein 63 (TP63, p63, Chronic Ulcerative Stomatitis Protein, CUSP, Keratinocyte Transcription Factor KET, Transformation-related Protein 63, Tumor Protein p73-like, p73L, TP73L, p40, p51, KET, P73H) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Tumor Protein 63 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TP63 tp63 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Tumor Protein 63, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.