Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (71.72kD).)

Mouse anti-Human Tubulin alpha-3C/D Chain Monoclonal Antibody | anti-TUBA3C antibody

Tubulin alpha-3C/D Chain (Alpha-tubulin 3C/D, TUBA3C, TUBA3D, Alpha-tubulin 2, Tubulin alpha-2 Chain, TUBA2, bA408E5.3) (Biotin)

Gene Names
TUBA3C; TUBA2; bA408E5.3
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Tubulin alpha-3C/D Chain; Monoclonal Antibody; Tubulin alpha-3C/D Chain (Alpha-tubulin 3C/D; TUBA3C; TUBA3D; Alpha-tubulin 2; Tubulin alpha-2 Chain; TUBA2; bA408E5.3) (Biotin); anti-TUBA3C antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3F10-2F2
Specificity
Recognizes human TUBA2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-TUBA3C antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-418 from human TUBA2 (AAH11721) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDLAALEKDYEEVGVDSVEAEAEEGEEY
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (71.72kD).)

Western Blot (WB) (Western Blot detection against Immunogen (71.72kD).)

Western Blot (WB)

(TUBA2 monoclonal antibody. Western Blot analysis of TUBA2 expression in Jurkat.)

Western Blot (WB) (TUBA2 monoclonal antibody. Western Blot analysis of TUBA2 expression in Jurkat.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TUBA2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to TUBA2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TUBA2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TUBA2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TUBA2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TUBA2 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-TUBA3C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
46,112 Da
NCBI Official Full Name
Homo sapiens tubulin, alpha 3c, mRNA
NCBI Official Synonym Full Names
tubulin alpha 3c
NCBI Official Symbol
TUBA3C
NCBI Official Synonym Symbols
TUBA2; bA408E5.3
NCBI Protein Information
tubulin alpha-3C/D chain
Protein Family

NCBI Description

Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene is an alpha tubulin gene that encodes a protein 99% identical to the mouse testis-specific Tuba3 and Tuba7 gene products. This gene is located in the 13q11 region, which is associated with the genetic diseases Clouston hidrotic ectodermal dysplasia and Kabuki syndrome. [provided by RefSeq, Jul 2008]

Research Articles on TUBA3C

Similar Products

Product Notes

The TUBA3C (Catalog #AAA6144982) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Tubulin alpha-3C/D Chain (Alpha-tubulin 3C/D, TUBA3C, TUBA3D, Alpha-tubulin 2, Tubulin alpha-2 Chain, TUBA2, bA408E5.3) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Tubulin alpha-3C/D Chain can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TUBA3C for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Tubulin alpha-3C/D Chain, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.