Mouse anti-Human Tuberin Monoclonal Antibody | anti-TSC2 antibody

Tuberin (Tuberous Sclerosis 2 Protein, TSC2, LAM, TSC4) (FITC)

Cat. Num. AAA6150251

• Gene Names: TSC2; LAM; TSC4; PPP1R160
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Tuberin; Monoclonal Antibody; Tuberin (Tuberous Sclerosis 2 Protein; TSC2; LAM; TSC4) (FITC); anti-TSC2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1C1
• Specificity: Recognizes human TSC2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 6415

• Applicable Applications for anti-TSC2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa540-658 from human TSC2 (NP_000539).
• Immunogen Sequence: SPPPELEERDVAAYSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYEMLVSHIQLHYKHSYTLPIASSIRLQAFDFLFLLRADSLHRLGLPNKDGVVRFSPYCVCDYMEPERGSEKK
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.83kD).)

Testing Data

(Detection limit for recombinant GST tagged TSC2 is 1ng/ml as a capture antibody.)

Product Categories/Family for anti-TSC2 antibody

Antibodies; Tumor Suppressors

NCBI and Uniprot Product Information

• NCBI GI #: 1519315310
• NCBI GeneID: 7249
• NCBI Accession #: NM_000548.5
• NCBI GenBank Nucleotide #: NM_000548
• UniProt Accession #: P49815
• NCBI Official Full Name: Homo sapiens TSC complex subunit 2 (TSC2), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: TSC complex subunit 2
• NCBI Official Symbol: TSC2
• NCBI Official Synonym Symbols: LAM; TSC4; PPP1R160
• NCBI Protein Information: tuberin
• UniProt Protein Name: Tuberin
• Protein Family: Tuberin
• UniProt Gene Name: TSC2
• UniProt Synonym Gene Names: TSC4
• UniProt Entry Name: TSC2_HUMAN

NCBI Description

Mutations in this gene lead to tuberous sclerosis complex. Its gene product is believed to be a tumor suppressor and is able to stimulate specific GTPases. The protein associates with hamartin in a cytosolic complex, possibly acting as a chaperone for hamartin. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

TSC2: a product of the tumor suppressor gene TSC2. Tuberin and Hamartin (TSC1) form a tumor suppressor heterodimer that inhibits the mTOR nutrient signaling input. TSC1/TSC2 targets the small G protein Rheb, a novel mediator of the nutrient signaling input to mTOR. Functions as a Rheb GTPase activating protein (GAP). Four alternatively spliced isoforms have been described.

Protein type: Tumor suppressor; GAPs, misc.; Cell cycle regulation; Nuclear receptor co-regulator; GAPs

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: TSC1-TSC2 complex; Golgi apparatus; cytoskeleton; growth cone; membrane; cell soma; perinuclear region of cytoplasm; cytoplasm; dendrite; caveola; nucleus; cytosol

Molecular Function: protein binding; protein homodimerization activity; protein heterodimerization activity; GTPase activator activity; phosphatase binding

Biological Process: negative regulation of MAP kinase activity; phosphoinositide 3-kinase cascade; regulation of insulin receptor signaling pathway; negative regulation of Wnt receptor signaling pathway; nerve growth factor receptor signaling pathway; protein heterooligomerization; regulation of cell cycle; heart development; negative regulation of insulin receptor signaling pathway; negative regulation of cell size; negative regulation of cell proliferation; protein localization; positive chemotaxis; cell projection organization and biogenesis; protein import into nucleus; regulation of endocytosis; acute-phase response; protein kinase B signaling cascade; cell cycle arrest; protein homooligomerization; negative regulation of epithelial cell proliferation; epidermal growth factor receptor signaling pathway; negative regulation of TOR signaling pathway; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; negative regulation of protein kinase B signaling cascade; endocytosis; vesicle-mediated transport; insulin-like growth factor receptor signaling pathway; glucose import; neural tube closure; insulin receptor signaling pathway; response to hypoxia; innate immune response; negative regulation of protein kinase activity; positive regulation of transcription from RNA polymerase II promoter; negative regulation of phosphoinositide 3-kinase cascade

Disease: Lymphangioleiomyomatosis; Tuberous Sclerosis 2