Mouse TUBB2A Monoclonal Antibody | anti-TUBB2A antibody

TUBB2A (Tubulin, beta 2A, TUBB, TUBB2, dJ40E16.7) (HRP)

Cat. Num. AAA6182796

• Gene Names: TUBB2A; TUBB; TUBB2; CDCBM5
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: TUBB2A; Monoclonal Antibody; TUBB2A (Tubulin; beta 2A; TUBB; TUBB2; dJ40E16.7) (HRP); Tubulin; dJ40E16.7; anti-TUBB2A antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4C8
• Specificity: Recognizes TUBB2A.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 445

• Applicable Applications for anti-TUBB2A antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TUBB2A (AAH01194, 1aa-445aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNTNDLVSEYQQYQDATADEQGEFEEEEGEDEA
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TUBB2A on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TUBB2A on HeLa cell. [antibody concentration 10 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TUBB2A on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TUBB2A on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml])

Western Blot (WB)

(TUBB2A monoclonal antibody (M09), clone 4C8. Western Blot analysis of TUBB2A expression in Jurkat.)

Product Categories/Family for anti-TUBB2A antibody

Antibodies; Tubulin

NCBI and Uniprot Product Information

• NCBI GI #: 12654709
• NCBI GeneID: 7280
• NCBI Official Full Name: Tubulin, beta 2A
• NCBI Official Synonym Full Names: tubulin beta 2A class IIa
• NCBI Official Symbol: TUBB2A
• NCBI Official Synonym Symbols: TUBB; TUBB2; CDCBM5
• NCBI Protein Information: tubulin beta-2A chain
• Protein Family: Tubulin

NCBI Description

Microtubules, key participants in processes such as mitosis and intracellular transport, are composed of heterodimers of alpha- and beta-tubulins. The protein encoded by this gene is a beta-tubulin. Defects in this gene are associated with complex cortical dysplasia with other brain malformations-5. Two transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2015]