Testing Data
(Detection limit for recombinant GST tagged TSFM is 0.3ng/ml as a capture antibody.)
Mouse anti-Human TSFM Monoclonal Antibody | anti-TSFM antibody
TSFM (Elongation Factor Ts, Mitochondrial, EFTS, EF-Ts, EFTSMT, EF-TsMt) (FITC)
Gene Names
TSFM; EFTS; EFTSMT
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TSFM; Monoclonal Antibody; TSFM (Elongation Factor Ts; Mitochondrial; EFTS; EF-Ts; EFTSMT; EF-TsMt) (FITC); anti-TSFM antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A2
Specificity
Recognizes human TSFM.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1997
Applicable Applications for anti-TSFM antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa161-260 from TSFM (NP_005717) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KVQWLTPVNLALWEAEAGGSLEGFLNSSELSGLPAGPDREGSLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVHGAMQSPSLHKLVLGKYGALVI
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged TSFM is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TSFM is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-TSFM antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens Ts translation elongation factor, mitochondrial (TSFM), transcript variant 2, mRNA
NCBI Official Synonym Full Names
Ts translation elongation factor, mitochondrial
NCBI Official Symbol
TSFM
NCBI Official Synonym Symbols
EFTS; EFTSMT
NCBI Protein Information
elongation factor Ts, mitochondrial
UniProt Protein Name
Elongation factor Ts, mitochondrial
UniProt Gene Name
TSFM
UniProt Entry Name
EFTS_HUMAN
NCBI Description
This gene encodes a mitochondrial translation elongation factor. The encoded protein is an enzyme that catalyzes the exchange of guanine nucleotides on the translation elongation factor Tu during the elongation step of mitchondrial protein translation. Mutations in this gene are associated with combined oxidative phosphorylation deficiency-3 syndrome. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Mar 2010]
Research Articles on TSFM
Similar Products
Product Notes
The TSFM tsfm (Catalog #AAA6150256) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TSFM (Elongation Factor Ts, Mitochondrial, EFTS, EF-Ts, EFTSMT, EF-TsMt) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TSFM can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TSFM tsfm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TSFM, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
