Western Blot (WB)
(Western Blot detection against Immunogen (36.01kD).)
Mouse anti-Human TRIM49 Monoclonal Antibody | anti-TRIM49 antibody
TRIM49 (Tripartite Motif-containing Protein 49, RING Finger Protein 18, Testis-specific RING-Finger Protein, RNF18) (HRP)
Gene Names
TRIM49; RNF18; TRIM49A; TRIM49L2
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRIM49; Monoclonal Antibody; TRIM49 (Tripartite Motif-containing Protein 49; RING Finger Protein 18; Testis-specific RING-Finger Protein; RNF18) (HRP); anti-TRIM49 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Clone Number
2E5
Specificity
Recognizes human TRIM49.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
1436
Applicable Applications for anti-TRIM49 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa251-341 from human TRIM49 (AAH75020) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ILHRSESVLLHMPQPLNPELSAGPITGLRDRLNQFRVHITLHHEEANNDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTFTSGK
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.01kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.01kD).)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to TRIM49 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to TRIM49 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)
Testing Data
(Detection limit for recombinant GST tagged TRIM49 is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TRIM49 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-TRIM49 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens tripartite motif-containing 49, mRNA
NCBI Official Synonym Full Names
tripartite motif containing 49
NCBI Official Symbol
TRIM49
NCBI Official Synonym Symbols
RNF18; TRIM49A; TRIM49L2
NCBI Protein Information
tripartite motif-containing protein 49
Protein Family
NCBI Description
The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This gene has been found to be preferentially expressed in testis. Related pseudogenes and gene duplicates have also been identified on chromosome 11. [provided by RefSeq, Aug 2010]
Research Articles on TRIM49
Similar Products
Product Notes
The TRIM49 (Catalog #AAA6155536) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRIM49 (Tripartite Motif-containing Protein 49, RING Finger Protein 18, Testis-specific RING-Finger Protein, RNF18) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM49 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIM49 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM49, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
