Mouse anti-Human TRIM47 Monoclonal Antibody | anti-TRIM47 antibody
TRIM47 (Tripartite Motif-containing Protein 47, Gene Overexpressed in Astrocytoma Protein, RING Finger Protein 100, GOA, RNF100) (MaxLight 550)
Gene Names
TRIM47; GOA; RNF100
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRIM47; Monoclonal Antibody; TRIM47 (Tripartite Motif-containing Protein 47; Gene Overexpressed in Astrocytoma Protein; RING Finger Protein 100; GOA; RNF100) (MaxLight 550); anti-TRIM47 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C8
Specificity
Recognizes human TRIM47.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-TRIM47 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa539-639 from human TRIM47 (NP_258411) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSRLDSHFAGLFTHRLKPAFFLESVDAHLQIGPLKKSCISVLKRR
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TRIM47 antibody
TRIM47 belongs to the TRIM/RBCC family. It contains one B box type zinc finger, one B30.2/SPRY domain and one RING type zinc finger. TRIM47 has low expression in most tissues; higher expression in kidney tubular cells and over expressed in astrocytoma tumor cells.
Product Categories/Family for anti-TRIM47 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44,410 Da
NCBI Official Full Name
tripartite motif-containing protein 47
NCBI Official Synonym Full Names
tripartite motif containing 47
NCBI Official Symbol
TRIM47
NCBI Official Synonym Symbols
GOA; RNF100
NCBI Protein Information
tripartite motif-containing protein 47; RING finger protein 100; gene overexpressed in astrocytoma protein; tripartite motif-containing 47
UniProt Protein Name
Tripartite motif-containing protein 47
Protein Family
UniProt Gene Name
TRIM47
UniProt Synonym Gene Names
GOA; RNF100
UniProt Entry Name
TRI47_HUMAN
Similar Products
Product Notes
The TRIM47 trim47 (Catalog #AAA6214537) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRIM47 (Tripartite Motif-containing Protein 47, Gene Overexpressed in Astrocytoma Protein, RING Finger Protein 100, GOA, RNF100) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM47 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIM47 trim47 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM47, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
