Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to TRIM46 on HeLa cell. [antibody concentration 10ug/ml].)
Mouse anti-Human TRIM46 Monoclonal Antibody | anti-TRIM46 antibody
TRIM46 (Tripartite Motif-containing Protein 46, Gene Y Protein, FLJ23229, GeneY, Tripartite, Fibronectin Type-III and C-terminal SPRY Motif Protein, TRIFIC) (HRP)
Gene Names
TRIM46; GENEY; TRIFIC
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRIM46; Monoclonal Antibody; TRIM46 (Tripartite Motif-containing Protein 46; Gene Y Protein; FLJ23229; GeneY; Tripartite; Fibronectin Type-III and C-terminal SPRY Motif Protein; TRIFIC) (HRP); anti-TRIM46 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G11
Specificity
Recognizes human TRIM46.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
759
Applicable Applications for anti-TRIM46 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa451-561 from human TRIM46 (NP_079334) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RLPPHSPPAWHYTVEFRRTDVPAQPGPTRWQRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDSRWGASRERLAISKDQRAVRSVPG
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to TRIM46 on HeLa cell. [antibody concentration 10ug/ml].)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to TRIM46 on HeLa cell. [antibody concentration 10ug/ml].)
Testing Data
(Detection limit for recombinant GST tagged TRIM46 is 1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TRIM46 is 1ng/ml as a capture antibody.)
Related Product Information for anti-TRIM46 antibody
Belongs to the TRIM/RBCC family. There are 4 isoforms of this protein.
Product Categories/Family for anti-TRIM46 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
tripartite motif-containing protein 46 isoform 1
NCBI Official Synonym Full Names
tripartite motif containing 46
NCBI Official Symbol
TRIM46
NCBI Official Synonym Symbols
GENEY; TRIFIC
NCBI Protein Information
tripartite motif-containing protein 46
UniProt Protein Name
Tripartite motif-containing protein 46
Protein Family
UniProt Gene Name
TRIM46
UniProt Synonym Gene Names
TRIFIC; GeneY
UniProt Entry Name
TRI46_HUMAN
Uniprot Description
Sequence similarities: Belongs to the TRIM/RBCC family.Contains 1 B box-type zinc finger.Contains 1 B30.2/SPRY domain.Contains 1 COS domain.Contains 1 fibronectin type-III domain.Contains 2 RING-type zinc fingers.
Similar Products
Product Notes
The TRIM46 trim46 (Catalog #AAA6155534) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRIM46 (Tripartite Motif-containing Protein 46, Gene Y Protein, FLJ23229, GeneY, Tripartite, Fibronectin Type-III and C-terminal SPRY Motif Protein, TRIFIC) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM46 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIM46 trim46 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM46, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
