Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to TRIM31 on HeLa cell. [antibody concentration 10ug/ml].)
Mouse anti-Human TRIM31 Monoclonal Antibody | anti-TRIM31 antibody
TRIM31 (E3 Ubiquitin-protein Ligase TRIM31, Tripartite Motif-containing Protein 31, C6orf13, RNF) (HRP)
Gene Names
TRIM31; RNF; HCG1; HCGI; C6orf13
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRIM31; Monoclonal Antibody; TRIM31 (E3 Ubiquitin-protein Ligase TRIM31; Tripartite Motif-containing Protein 31; C6orf13; RNF) (HRP); anti-TRIM31 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G11
Specificity
Recognizes human TRIM31.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-TRIM31 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from human TRIM31 (NP_008959) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to TRIM31 on HeLa cell. [antibody concentration 10ug/ml].)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to TRIM31 on HeLa cell. [antibody concentration 10ug/ml].)
Testing Data
(Detection limit for recombinant GST tagged TRIM31 is 3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TRIM31 is 3ng/ml as a capture antibody.)
Related Product Information for anti-TRIM31 antibody
The TRIM motif includes three zinc binding domains, a RING, a B box type 1 and a B box type 2, and a coiled-coil region. The protein localizes to both the cytoplasm and the nucleus. Its function has not been identified.
Product Categories/Family for anti-TRIM31 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM31
NCBI Official Synonym Full Names
tripartite motif containing 31
NCBI Official Symbol
TRIM31
NCBI Official Synonym Symbols
RNF; HCG1; HCGI; C6orf13
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM31
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM31
Protein Family
UniProt Gene Name
TRIM31
UniProt Synonym Gene Names
C6orf13; RNF
UniProt Entry Name
TRI31_HUMAN
NCBI Description
This gene encodes a protein that functions as an E3 ubiquitin-protein ligase. This gene shows altered expression in certain tumors and may be a negative regulator of cell growth. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Research Articles on TRIM31
Similar Products
Product Notes
The TRIM31 trim31 (Catalog #AAA6155530) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRIM31 (E3 Ubiquitin-protein Ligase TRIM31, Tripartite Motif-containing Protein 31, C6orf13, RNF) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM31 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIM31 trim31 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM31, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
