Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.56kD))

Mouse anti-Human TRIM26 Monoclonal Antibody | anti-TRIM26 antibody

TRIM26 (Tripartite Motif-containing Protein 26, Acid Finger Protein, AFP, RING Finger Protein 95, Zinc Finger Protein 173, RNF95, ZNF173) (HRP)

Gene Names
TRIM26; AFP; RNF95; ZNF173
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRIM26; Monoclonal Antibody; TRIM26 (Tripartite Motif-containing Protein 26; Acid Finger Protein; AFP; RING Finger Protein 95; Zinc Finger Protein 173; RNF95; ZNF173) (HRP); anti-TRIM26 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G3
Specificity
Recognizes human TRIM26.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
539
Applicable Applications for anti-TRIM26 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa146-241 from human TRIM26 (NP_003440) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
REKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVIS*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.56kD))

Western Blot (WB) (Western Blot detection against Immunogen (36.56kD))

Western Blot (WB)

(Western Blot analysis of TRIM26 expression in transfected 293T cell line by TRIM26 monoclonal antibody Lane 1: TRIM26 transfected lysate (Predicted MW: 62.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TRIM26 expression in transfected 293T cell line by TRIM26 monoclonal antibody Lane 1: TRIM26 transfected lysate (Predicted MW: 62.2kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TRIM26 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TRIM26 is 1ng/ml as a capture antibody.)
Related Product Information for anti-TRIM26 antibody
TRIM26 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Although the function of the protein is unknown, the RING domain suggests that the protein may have DNA-binding activity.
Product Categories/Family for anti-TRIM26 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
tripartite motif-containing protein 26
NCBI Official Synonym Full Names
tripartite motif containing 26
NCBI Official Symbol
TRIM26
NCBI Official Synonym Symbols
AFP; RNF95; ZNF173
NCBI Protein Information
tripartite motif-containing protein 26
UniProt Protein Name
Tripartite motif-containing protein 26
UniProt Gene Name
TRIM26
UniProt Synonym Gene Names
RNF95; ZNF173; AFP
UniProt Entry Name
TRI26_HUMAN

NCBI Description

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Although the function of the protein is unknown, the RING domain suggests that the protein may have DNA-binding activity. The gene localizes to the major histocompatibility complex (MHC) class I region on chromosome 6. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jun 2011]

Uniprot Description

TRIM26: is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Although the function of the protein is unknown, the RING domain suggests that the protein may have DNA-binding activity. The gene localizes to the major histocompatibility complex (MHC) class I region on chromosome 6. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jun 2011]

Protein type: DNA-binding; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: cytosol

Molecular Function: DNA binding; zinc ion binding; metal ion binding

Biological Process: negative regulation of virion penetration into host cell; cytokine and chemokine mediated signaling pathway; innate immune response; positive regulation of transcription factor activity

Research Articles on TRIM26

Similar Products

Product Notes

The TRIM26 trim26 (Catalog #AAA6155529) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRIM26 (Tripartite Motif-containing Protein 26, Acid Finger Protein, AFP, RING Finger Protein 95, Zinc Finger Protein 173, RNF95, ZNF173) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM26 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIM26 trim26 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM26, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.