Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against immunogen (32.23kD).)

Mouse anti-Human Trefoil Factor 3 Monoclonal Antibody | anti-TFF3 antibody

Trefoil Factor 3 (TFF3, Intestinal Trefoil Factor, hITF, Polypeptide P1.B, hP1.B, ITF, TFI) (PE)

Gene Names
TFF3; ITF; P1B; TFI
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Trefoil Factor 3; Monoclonal Antibody; Trefoil Factor 3 (TFF3; Intestinal Trefoil Factor; hITF; Polypeptide P1.B; hP1.B; ITF; TFI) (PE); anti-TFF3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3D9
Specificity
Recognizes human Trefoil Factor 3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
491
Applicable Applications for anti-TFF3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa15-7a from human Trefoil Factor 3 (AAH17859) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen (32.23kD).)

Western Blot (WB) (Western Blot detection against immunogen (32.23kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase to TFF3 on formalin-fixed paraffin-embedded human small Intestine using 134701 (3ug/ml).)

Immunohistochemistry (IHC) (Immunoperoxidase to TFF3 on formalin-fixed paraffin-embedded human small Intestine using 134701 (3ug/ml).)

Testing Data

(Detection limit for 134701 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for 134701 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-TFF3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens trefoil factor 3 (intestinal), mRNA
NCBI Official Synonym Full Names
trefoil factor 3
NCBI Official Symbol
TFF3
NCBI Official Synonym Symbols
ITF; P1B; TFI
NCBI Protein Information
trefoil factor 3
Protein Family

NCBI Description

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq, Jul 2008]

Research Articles on TFF3

Similar Products

Product Notes

The TFF3 (Catalog #AAA6160820) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Trefoil Factor 3 (TFF3, Intestinal Trefoil Factor, hITF, Polypeptide P1.B, hP1.B, ITF, TFI) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Trefoil Factor 3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TFF3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Trefoil Factor 3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.