Mouse TP53 Monoclonal Antibody | anti-TP53 antibody

TP53 (Tumor Protein p53, FLJ92943, LFS1, TRP53, p53) (FITC)

Cat. Num. AAA6174998

• Gene Names: TP53; P53; BCC7; LFS1; BMFS5; TRP53
• Applications: Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified
• Synonyms: TP53; Monoclonal Antibody; TP53 (Tumor Protein p53; FLJ92943; LFS1; TRP53; p53) (FITC); Tumor Protein p53; p53; anti-TP53 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C3
• Specificity: Recognizes TP53.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 393

• Applicable Applications for anti-TP53 antibody: Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TP53 (AAH03596, 94aa-201aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNL
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to TP53 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TP53 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TP53 on A-431 cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TP53 on A-431 cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(TP53 monoclonal antibody (M01), clone 2C3 Western Blot analysis of TP53 expression in A-431 (Cat # L015V1).)

Testing Data

(Detection limit for recombinant GST tagged TP53 is approximately 1ng/ml as a capture antibody.)

Related Product Information for anti-TP53 antibody

This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity. [provided by RefSeq]

Product Categories/Family for anti-TP53 antibody

Antibodies; Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 13097807
• NCBI GeneID: 7157
• NCBI Official Full Name: Tumor protein p53
• NCBI Official Synonym Full Names: tumor protein p53
• NCBI Official Symbol: TP53
• NCBI Official Synonym Symbols: P53; BCC7; LFS1; BMFS5; TRP53
• NCBI Protein Information: cellular tumor antigen p53
• Protein Family: TP53-regulating kinase

NCBI Description

This gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers, including hereditary cancers such as Li-Fraumeni syndrome. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoforms. Additional isoforms have also been shown to result from the use of alternate translation initiation codons from identical transcript variants (PMIDs: 12032546, 20937277). [provided by RefSeq, Dec 2016]