Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged TOPORS is approximately 3ng/ml as a capture antibody.)

Mouse TOPORS Monoclonal Antibody | anti-TOPORS antibody

TOPORS (Topoisomerase I Binding, Arginine/Serine-Rich, LUN, P53BP3, RP31, TP53BPL) (APC)

Applications
Western Blot
Purity
Purified
Synonyms
TOPORS; Monoclonal Antibody; TOPORS (Topoisomerase I Binding; Arginine/Serine-Rich; LUN; P53BP3; RP31; TP53BPL) (APC); Topoisomerase I Binding; TP53BPL; anti-TOPORS antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6D2
Specificity
Recognizes TOPORS.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1045
Applicable Applications for anti-TOPORS antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TOPORS (NP_005793, 98aa-205aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TOPORS is approximately 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TOPORS is approximately 3ng/ml as a capture antibody.)
Related Product Information for anti-TOPORS antibody
Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Product Categories/Family for anti-TOPORS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
E3 ubiquitin-protein ligase Topors isoform 1
UniProt Protein Name
E3 ubiquitin-protein ligase Topors
UniProt Gene Name
TOPORS
UniProt Synonym Gene Names
LUN; TP53BPL; p53-binding protein 3; p53BP3
UniProt Entry Name
TOPRS_HUMAN

Uniprot Description

TOPORS: Functions as an E3 ubiquitin-protein ligase and as an E3 SUMO1-protein ligase. Probable tumor suppressor involved in cell growth, cell proliferation and apoptosis that regulates p53/TP53 stability through ubiquitin-dependent degradation. May regulate chromatin modification through sumoylation of several chromatin modification-associated proteins. May be involved in DNA damage- induced cell death through IKBKE sumoylation. Interacts with PARK7/DJ-1. Interacts with TOP1. Interacts with p53/TP53; can both ubiquitinate and sumoylate p53/TP53. Interacts with the SUMO1 conjugating enzyme UBE2I. Interacts with SUMO1. Interacts with NKX3-1; polyubiquitinates NKX3-1 and induces its proteasomal degradation. Interacts with SIN3A; sumoylates SIN3A. Interacts with IKBKE; induced by DNA damage. By genotoxic agents such as cisplatin and camptothecin. Expressed at highest levels in testis and at lower levels in adrenal gland, bone marrow, brain, colon, heart, kidney, liver, muscle, ovary, pancreas, placenta, prostate, skeletal muscle, skin, small intestine, spleen, stomach, testis, thymus, thyroid and uterus. Expressed in the alveolar epithelium of the lung. Expression is commonly decreased in colon adenocarcinomas and lung cancers. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.-; Ligase; Ubiquitin ligase; Cell cycle regulation; Ubiquitin conjugating system; EC 6.3.2.19

Chromosomal Location of Human Ortholog: 9p21

Cellular Component: centriole; spindle pole; PML body; cytoplasmic dynein complex; nuclear speck; midbody; nucleus; photoreceptor connecting cilium; ubiquitin ligase complex; gamma-tubulin complex

Molecular Function: protein binding; DNA binding; zinc ion binding; ubiquitin-protein ligase activity; SUMO ligase activity; antigen binding; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; protein monoubiquitination; proteasomal ubiquitin-dependent protein catabolic process; retinal rod cell development; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; regulation of cell proliferation; protein sumoylation; retinal cone cell development; DNA damage response, signal transduction resulting in induction of apoptosis; positive regulation of ubiquitin-protein ligase activity; maintenance of protein localization in nucleus; response to DNA damage stimulus; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; negative regulation of apoptosis

Disease: Retinitis Pigmentosa 31

Similar Products

Product Notes

The TOPORS topors (Catalog #AAA6168702) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TOPORS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TOPORS topors for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TOPORS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.