Western Blot (WB)
(Western Blot detection against Immunogen (31.79kD).)
Mouse anti-Human TNP1 Monoclonal Antibody | anti-tnp1 antibody
TNP1 (Spermatid Nuclear Transition Protein 1, STP-1, TP1, TP-1)
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
TNP1; Monoclonal Antibody; TNP1 (Spermatid Nuclear Transition Protein 1; STP-1; TP1; TP-1); Anti -TNP1 (Spermatid Nuclear Transition Protein 1; anti-tnp1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1B5
Specificity
Recognizes human TNP1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL
Applicable Applications for anti-tnp1 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Full length recombinant corresponding to aa1-55 from human TNP (AAH29516)1 with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (31.79kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (31.79kD).)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to TNP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to TNP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])
Testing Data
(Detection limit for recombinant GST tagged TNP1 is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TNP1 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-tnp1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,901 Da
NCBI Official Full Name
Tnp1
NCBI Official Symbol
tnp1
NCBI Protein Information
IS431/257 transposase; Tnp1
UniProt Protein Name
Tnp1
Protein Family
UniProt Gene Name
tpn
UniProt Synonym Gene Names
tnp
UniProt Entry Name
Q9FDP7_STAAU
Similar Products
Product Notes
The tnp1 tpn (Catalog #AAA6005706) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TNP1 (Spermatid Nuclear Transition Protein 1, STP-1, TP1, TP-1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TNP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the tnp1 tpn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSTSRKLKSH GMRRSKSRSP HKGVKRGGSK RKYRKGNLKS RKRGDDANRN YRSHL. It is sometimes possible for the material contained within the vial of "TNP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
