Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human TNFSF9 Monoclonal Antibody | anti-TNFSF9 antibody

TNFSF9 (Tumor Necrosis Factor Ligand Superfamily Member 9, 4-1BB Ligand, 4-1BBL, 4-1BB-L) (MaxLight 550)

Gene Names
TNFSF9; CD137L; TNLG5A; 4-1BB-L
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TNFSF9; Monoclonal Antibody; TNFSF9 (Tumor Necrosis Factor Ligand Superfamily Member 9; 4-1BB Ligand; 4-1BBL; 4-1BB-L) (MaxLight 550); anti-TNFSF9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D7
Specificity
Recognizes human TNFSF9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-TNFSF9 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa145-255 from TNFSF9 (NP_003802) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TNFSF9 antibody
MaxLight550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor546, 555, DyLight549, Cy3, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
Product Categories/Family for anti-TNFSF9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23.8 kDa (222aa), confirmed by MALDI-TOF.
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 9
NCBI Official Synonym Full Names
TNF superfamily member 9
NCBI Official Symbol
TNFSF9
NCBI Official Synonym Symbols
CD137L; TNLG5A; 4-1BB-L
NCBI Protein Information
tumor necrosis factor ligand superfamily member 9
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 9
UniProt Gene Name
TNFSF9
UniProt Synonym Gene Names
4-1BBL
UniProt Entry Name
TNFL9_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction.[provided by RefSeq, Oct 2008]

Uniprot Description

TNFL9: Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages. Belongs to the tumor necrosis factor family.

Protein type: Cell cycle regulation; Membrane protein, integral; Cytokine; Apoptosis

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: extracellular space; plasma membrane; integral to membrane

Molecular Function: cytokine activity; tumor necrosis factor receptor binding; receptor binding

Biological Process: cell proliferation; positive regulation of interferon-gamma production; positive regulation of cytotoxic T cell differentiation; cell-cell signaling; apoptosis; positive regulation of interleukin-12 production; positive regulation of interleukin-6 production; immune response; myeloid dendritic cell differentiation; signal transduction; positive regulation of activated T cell proliferation

Research Articles on TNFSF9

Similar Products

Product Notes

The TNFSF9 tnfsf9 (Catalog #AAA6214464) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TNFSF9 (Tumor Necrosis Factor Ligand Superfamily Member 9, 4-1BB Ligand, 4-1BBL, 4-1BB-L) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TNFSF9 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TNFSF9 tnfsf9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TNFSF9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.