Mouse anti-Human TNFSF14 Monoclonal Antibody | anti-TNFSF14 antibody

TNFSF14 (Tumor Necrosis Factor Ligand Superfamily Member 14, CD258, Herpes Virus Entry Mediator Ligand, Herpes virus Entry Mediator Ligand, HVEML, HVEM-L, LIGHT, LTg, TR2, UNQ391/PRO726) (PE)

Cat. Num. AAA6160763

• Gene Names: TNFSF14; LTg; CD258; HVEML; LIGHT
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TNFSF14; Monoclonal Antibody; TNFSF14 (Tumor Necrosis Factor Ligand Superfamily Member 14; CD258; Herpes Virus Entry Mediator Ligand; Herpes virus Entry Mediator Ligand; HVEML; HVEM-L; LIGHT; LTg; TR2; UNQ391/PRO726) (PE); anti-TNFSF14 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4E3
• Specificity: Recognizes human TNFSF14.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-TNFSF14 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa61-170 from TNFSF14 (AAH18058) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGVAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRT
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB)

(Western Blot analysis of TNFSF14 expression in transfected 293T cell line by TNFSF14 monoclonal antibody Lane 1: TNFSF14 transfected lysate (22.4kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TNFSF14 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3ug/ml.)

Immunoprecipitation (IP)

(Immunoprecipitation of TNFSF14 transfected lysate using TNFSF14 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TNFSF14 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged TNFSF14 is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-TNFSF14 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 17390119
• NCBI GeneID: 8740
• Molecular Weight: 22,395 Da
• NCBI Official Full Name: Homo sapiens tumor necrosis factor (ligand) superfamily, member 14, mRNA
• NCBI Official Synonym Full Names: tumor necrosis factor superfamily member 14
• NCBI Official Symbol: TNFSF14
• NCBI Official Synonym Symbols: LTg; CD258; HVEML; LIGHT
• NCBI Protein Information: tumor necrosis factor ligand superfamily member 14
• Protein Family: Tumor necrosis factor ligand superfamily

NCBI Description

The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]